Protein

MIA_03978_1

Length
170 amino acids


Browser: contig05:411658-412253-

Protein function

EGGNOG:0PQQDCBF NF-Y family transcription factor
SGD closest match:S000000961BUR6Negative cofactor 2 complex subunit alpha
CGD closest match:CAL0000181542HFL2Negative cofactor 2 transcription regulator complex subunit

Protein alignments

%idAln lengthE-value
MCA_02170_185.56%905e-52MCA_02170_1
A0A0J9XFF8_GEOCN86.36%885e-52Similar to Saccharomyces cerevisiae YER159C BUR6 Subunit of a heterodimeric NC2 transcription regulator complex with Ncb2p OS=Geotrichum candidum GN=BN980_GECA13s01528g PE=4 SV=1
A0A1E3PSL1_9ASCO78.16%871e-45DNA polymerase epsilon subunit C OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44627 PE=4 SV=1
DPB3_YARLI76.47%857e-42DNA polymerase epsilon subunit C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DPB3 PE=3 SV=1
UniRef50_Q6C6M576.47%852e-38DNA polymerase epsilon subunit C n=4 Tax=Dikarya TaxID=451864 RepID=DPB3_YARLI
A0A060TE24_BLAAD74.12%852e-41ARAD1D48576p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D48576g PE=4 SV=1
A0A1D8PLM5_CANAL57.83%831e-30Negative cofactor 2 transcription regulator complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HFL2 PE=4 SV=1
A0A1E4TDT1_9ASCO54.65%861e-30Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_27297 PE=4 SV=1
NCB1_YEAST47.50%802e-21Negative cofactor 2 complex subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUR6 PE=1 SV=1
A0A167FE48_9ASCO29.11%792e-08Transcriptional activator OS=Sugiyamaella lignohabitans GN=HAP5 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2240
Predicted cleavage: 13

Protein family membership

None predicted.

Domains and repeats

1 20 40 60 80 100 120 140 160 170

Detailed signature matches

    1. SSF47113 (Histone-fold)
    1. PF00808 (CBFD_NFYB_HMF)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_03978_1
MTPIKKEIKTRFPVARIKRLMQSDEDIGKVAQATPIIVAKALELFMVSLIEESCKQARERNAKRVSPAHLKQAVKSVEHF
DFLEETVRKYPDPVGPAVPSPAAAAAAAAAAAAAAAAAAEATAAEGSGASAGTDTADTTESTPTGPTTSLSAAGPDDESE
DTGSSNSSDE

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0046982 protein heterodimerization activity

Cellular Component

None predicted.