Protein
MIA_03849_1
Length
225 amino acids
Browser: contig05:48851-49630-
Protein function
EGGNOG: | 0PMWX | TRS31 | Transport protein particle |
---|---|---|---|
SGD closest match: | S000002880 | TRS31 | Trafficking protein particle complex subunit 31 |
CGD closest match: | CAL0000190083 | CAALFM_CR10390WA | TRAPP subunit |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_02275_1 | 78.199% | 211 | 5.03e-111 | MCA_02275_1 |
A0A0J9X4H7_GEOCN | 77.473% | 182 | 7.28e-97 | Similar to Saccharomyces cerevisiae YDR472W TRS31 One of 10 subunits of the transport protein particle (TRAPP) complex of the cis-Golgi OS=Geotrichum candidum GN=BN980_GECA02s05169g PE=4 SV=1 |
A0A060SY36_BLAAD | 67.778% | 180 | 7.52e-84 | ARAD1A17600p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17600g PE=4 SV=1 |
UniRef50_U4LGH5 | 62.019% | 208 | 1.61e-72 | Similar to Transport protein particle subunit trs31 acc. no. Q9P7N9 n=102 Tax=Pezizomycotina TaxID=147538 RepID=U4LGH5_PYROM |
A0A161HJU1_9ASCO | 67.039% | 179 | 2.48e-74 | Trs31p OS=Sugiyamaella lignohabitans GN=TRS31 PE=4 SV=1 |
Q6CFM1_YARLI | 54.359% | 195 | 1.59e-66 | YALI0B05720p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B05720g PE=4 SV=1 |
A0A1E4TLA8_9ASCO | 52.459% | 183 | 3.21e-64 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_87698 PE=4 SV=1 |
A0A1D8PU84_CANAL | 53.158% | 190 | 1.54e-58 | TRAPP subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR10390WA PE=4 SV=1 |
A0A1E3PRI4_9ASCO | 67.391% | 92 | 6.12e-41 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81000 PE=4 SV=1 |
TRS31_YEAST | 42.241% | 116 | 1.16e-23 | Trafficking protein particle complex subunit 31 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRS31 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.5935
Predicted cleavage: 26
Protein family membership
- Transport protein particle (TRAPP) component (IPR007194)
- TRAPP I complex, subunit 5 (IPR016696)
Domains and repeats
-
Domain
1
50
100
150
200
225
Detailed signature matches
-
-
PF04051 (TRAPP)
-
-
-
cd14943 (TRAPPC5_Trs31)
-
PIRSF017479 (TRAPP_...)
-
-
-
SSF111126 (Ligand-b...)
-
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Residue annotation
-
BET3 interface cd1...
-
sedlin interface c...
Protein sequence
>MIA_03849_1 MSSSQSAIIIPSSKTPQTGKSLLRQQPLGPSGSFSSTPIKSIYEKNLSRRAPDLSLSSFSFLFGEAIQYLQKQSSGIQDL EKKLNELGYRIGLRTLELLTLRDGKSAKRETKVLGVLQFINTTMWRALFGKQADGLEKSRDSEYEYMIIDNCPLVSQFIS VPKEKSQLSCAAFIAGIIEAVLDGYVFTAKVTAHTVQTEEFPLRTVFLIKFKPEVINREASYKLR
GO term prediction
Biological Process
GO:0048193 Golgi vesicle transport
Molecular Function
None predicted.
Cellular Component
GO:0030008 TRAPP complex