Protein

MIA_03804_1

Length
322 amino acids


Browser: contig04:2207609-2208683+

Protein function

EGGNOG:0PJNUPGUG_01266Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is involved in protein synthesis and, together with other initiation factors, stimulates binding of mRNA and methionyl-tRNAi to the 40S ribosome (By similarity)
SGD closest match:S000005787RPN826S proteasome regulatory subunit RPN8
CGD closest match:CAL0000198925orf19.4283Uncharacterized protein

Protein alignments

%idAln lengthE-value
MCA_03562_163.526%3295.95e-136MCA_03562_1
A0A0J9XJL6_GEOCN56.627%3321.53e-122Eukaryotic translation initiation factor 3 subunit F OS=Geotrichum candidum GN=BN980_GECA21s01550g PE=3 SV=1
UniRef50_A0A0J9XJL656.627%3323.13e-119Eukaryotic translation initiation factor 3 subunit F n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XJL6_GEOCN
A0A167CCZ1_9ASCO53.313%3321.34e-118Eukaryotic translation initiation factor 3 subunit F OS=Sugiyamaella lignohabitans GN=AWJ20_4341 PE=3 SV=1
A0A060T5B9_BLAAD53.106%3222.78e-114Eukaryotic translation initiation factor 3 subunit F OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B03344g PE=3 SV=1
EIF3F_YARLI49.032%3101.92e-96Eukaryotic translation initiation factor 3 subunit F OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0E26851g PE=3 SV=1
A0A1E3PNE7_9ASCO43.413%3342.19e-95Mov34-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81587 PE=3 SV=1
A0A1E4TD98_9ASCO32.808%3171.56e-54Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32899 PE=4 SV=1
Q5AG96_CANAL27.586%3484.09e-31Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4283 PE=4 SV=1
RPN8_YEAST22.697%3044.83e-0826S proteasome regulatory subunit RPN8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPN8 PE=1 SV=3

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.4726
Predicted cleavage: 53

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 322

Detailed signature matches

    1. cd08064 (MPN_eIF3f)
    2. MF_03005 (eIF3f)
    1. SM00232 (pad1_6)
    2. PF01398 (JAB)
    1. PF13012 (MitMem_reg)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MIA_03804_1
MSDSFLYVPRPTPAGSPSNVLVQAQAVFQILDHALRNGNAPNRVIGVLLGVRSDDGSEIEVRSSFAVPHDEINNQITIDV
DYLRSMYNLHRRAYSRDAIVGWYTTSSELDNLSGLMHDFFSASDNGLISHTPIHLTVSTYETLTAASAEAEPSTEGSDKT
KPQFPKDISVRTYVSSPVGIANEKSRGSLFFVPIPNEVRFSEVERSGLDAIAKARDEPSRSISLVNDIQALETTLVKVLD
MLDRVSAYVNDIIEANKSVQPSPTSVAIGKFLHKNLALVPSISKENLEKLFNSHLQDVLMVVYLANTVKSQLQLSSRLTP
IV

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003743 translation initiation factor activity
GO:0005515 protein binding

Cellular Component

GO:0005737 cytoplasm
GO:0005852 eukaryotic translation initiation factor 3 complex