Protein

MIA_03803_1

Length
277 amino acids


Browser: contig04:2202145-2202979-

Protein function

EGGNOG:0PPRBMCM1Transcription factor
SGD closest match:S000004646MCM1Pheromone receptor transcription factor
CGD closest match:CAL0000194125MCM1Transcription factor of morphogenesis MCM1

Protein alignments

%idAln lengthE-value
MCA_03563_198.718%783.75e-36MCA_03563_1
A0A0J9X877_GEOCN90.805%872.01e-36Similar to Saccharomyces cerevisiae YMR043W MCM1Transcription factor involved in cell-type-specific transcription and pheromone response OS=Geotrichum candidum GN=BN980_GECA05s04542g PE=4 SV=1
A0A167E400_9ASCO97.436%781.22e-35Transcription factor MCM1 OS=Sugiyamaella lignohabitans GN=MCM1 PE=4 SV=1
UniRef50_M2MTG185.106%941.43e-32Uncharacterized protein n=9 Tax=Fungi TaxID=4751 RepID=M2MTG1_BAUCO
A0A060SYL0_BLAAD93.902%822.77e-35ARAD1A13090p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A13090g PE=4 SV=1
Q6CCS9_YARLI92.593%814.15e-35YALI0C06842p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C06842g PE=4 SV=1
MCM1_CANAL94.872%787.47e-34Transcription factor of morphogenesis MCM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCM1 PE=1 SV=1
A0A1E3PJA7_9ASCO94.737%761.82e-32SRF-TF-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82568 PE=4 SV=1
A0A1E4TE23_9ASCO94.872%785.44e-34Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_13507 PE=4 SV=1
MCM1_YEAST83.117%774.54e-29Pheromone receptor transcription factor OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCM1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0017

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 277

Detailed signature matches

    1. PS00350 (MADS_BOX_1)
    2. PF00319 (SRF-TF)
    3. SSF55455 (SRF-like)
    4. PR00404 (MADSDOMAIN)
    5. PS50066 (MADS_BOX_2)
    6. SM00432 (madsneu2)
    1. cd00266 (MADS_SRF_like)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. DNA binding site c...
  2. dimerization inter...
  3. protein interactio...
  4. putative phosphory...

Protein sequence

>MIA_03803_1
MDPQDPQVAPQNPGEPGPDMNSTLQEAPLGGPNQQISQVKRERMMEEDEDDEDERKSGRERRKIEIKFIPDKSRRHITFS
KRKAGIMKKAYELSVLTGTQVLLLVVSETGLVYTFTTPKLQPLVTEPEGKNLIQACLNAPETRPNGHDMAAPMTDPAFDP
NQQAQQQAQQDAVAAVQRQQQEHLQAQSHVHPQSQQQPQSQQPSPSTLGNQVPQHMSSPGMSNQGLPRASMPQAPVPLQH
GLGGYIPDQQFSYMPPIQAPPQQQRYLNPHQNPSPGN

GO term prediction

Biological Process

GO:0045944 positive regulation of transcription from RNA polymerase II promoter

Molecular Function

GO:0000982 transcription factor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0000987 core promoter proximal region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity

Cellular Component

None predicted.