Protein
MIA_03759_1
Length
93 amino acids
Browser: contig04:2069606-2069947-
Protein function
EGGNOG: | 0PS65 | FG10512.1 | mitochondrial 37S ribosomal protein YmS-T |
---|---|---|---|
SGD closest match: | S000006430 | MRP10 | 37S ribosomal protein MRP10, mitochondrial |
CGD closest match: | CAL0000177633 | orf19.2650.1 | 37S ribosomal protein mrp10, mitochondrial |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_04725_1 | 73.810% | 84 | 1.05e-42 | MCA_04725_1 |
A0A0J9XJ82_GEOCN | 64.835% | 91 | 3.31e-40 | Similar to Saccharomyces cerevisiae YDL045W-A MRP10 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA21s00098g PE=4 SV=1 |
UniRef50_A0A0J9XJ82 | 64.835% | 91 | 6.76e-37 | Similar to Saccharomyces cerevisiae YDL045W-A MRP10 Mitochondrial ribosomal protein of the small subunit n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XJ82_GEOCN |
A0A060SXY1_BLAAD | 49.451% | 91 | 3.86e-24 | ARAD1A16104p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A16104g PE=4 SV=1 |
A0A1E3PFV0_9ASCO | 47.619% | 84 | 5.74e-20 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53411 PE=4 SV=1 |
MRP10_YEAST | 41.053% | 95 | 1.73e-19 | 37S ribosomal protein MRP10, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP10 PE=1 SV=1 |
A0A1D8PNP0_CANAL | 36.842% | 76 | 1.15e-13 | 37S ribosomal protein mrp10, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2650.1 PE=3 SV=1 |
Q6C291_YARLI | 39.286% | 84 | 5.84e-12 | 37S ribosomal protein mrp10, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F09768g PE=3 SV=1 |
A0A1E4TFP3_9ASCO | 32.432% | 74 | 2.67e-11 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_108122 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.6710
Predicted cleavage: 20
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
-
PS51808 (CHCH)
Protein sequence
>MIA_03759_1 MSSLSGKQPRLKHLAKLRVKSTAAKTAGGPCSVALTNLLSCWASNGHDAPTCANFAQELKLCMATRSTARAGKSSINYHA ARLKDKVSPPSYD
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.