Protein

MIA_03612_1

Length
237 amino acids


Browser: contig04:1693339-1694053-

Protein function

EGGNOG:0PKWEMHR1Transcription factor involved in regulation of RNA polymerase II-dependent transcription. Also involved in regulation of mitochondrial DNA recombination, maintenance and repair, and generation of homoplasmic cells
SGD closest match:S000002704MHR1Mitochondrial homologous recombination protein 1
CGD closest match:CAL0000174972MHR1Mitochondrial homologous recombination protein 1

Protein alignments

%idAln lengthE-value
MCA_04185_173.134%2012.52e-116MCA_04185_1
A0A060SXI6_BLAAD54.011%1872.85e-71ARAD1A09724p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A09724g PE=4 SV=1
UniRef50_A0A060SXI654.011%1877.04e-68ARAD1A09724p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SXI6_BLAAD
A0A161HHZ8_9ASCO49.735%1891.01e-67Mhr1p OS=Sugiyamaella lignohabitans GN=MHR1 PE=4 SV=1
A0A1E3PDW4_9ASCO46.114%1937.14e-60Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84152 PE=4 SV=1
MHR1_CANAL48.538%1715.23e-56Mitochondrial homologous recombination protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MHR1 PE=3 SV=1
MHR1_YARLI43.125%1601.55e-46Mitochondrial homologous recombination protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MHR1 PE=3 SV=1
MHR1_YEAST44.886%1765.19e-42Mitochondrial homologous recombination protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MHR1 PE=1 SV=1
A0A1E4TDB0_9ASCO40.645%1551.07e-31Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_15521 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7679
Predicted cleavage: 29

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_03612_1
MSGVNHRALKIFGNHFGGRFRHPAFLRRHGYGPDVFLFRNLESGQVMYTQLPFPQAYNIKTQFQNPNWQNRLPDIRRDIW
RPMAMAQLPTYPLAVELYESLVTLRHYRDKLFKKEANDWRKRNSDGNIWYSGQYRPTYSQEAVADLASVLNAFDVEAKVL
WDGVWRKGQDEYWKTSITHDELPAFNPRDSYAALRQLGYDHYLEFQQAQKEAYEAKKASAEAPAEAPAAEAPAAPAN

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.