Protein
MIA_03382_1
Length
74 amino acids
Browser: contig04:1055094-1055319-
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01748_1 | 39.744% | 78 | 2.02e-17 | MCA_01748_1 |
| A0A167DFI7_9ASCO | 43.056% | 72 | 6.80e-14 | Polyprotein of L1-like non-LTR retrotransposon Zorro 3 OS=Sugiyamaella lignohabitans GN=POL92 PE=4 SV=1 |
| UniRef50_A0A167E0Q8 | 36.986% | 73 | 1.06e-09 | RnaseH domain, transposon factor n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A167E0Q8_9ASCO |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.1209
Predicted cleavage: 16
Protein family membership
None predicted.
Domains and repeats
None predicted.
Protein sequence
>MIA_03382_1 MSHGTFGAWFKRFRIHSNSYGELETARHILVECPLLEENRKGLRRISPEMDMSTLLNSLTGLQEIARFISVWRE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.