Protein

MIA_03312_1

Length
422 amino acids

Browser: contig04:841176-842445-

Protein function

EGGNOG:0PH4PFG07217.1synthase
SGD closest match:S000004545DUS1tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]
CGD closest match:CAL0000188810orf19.1404tRNA dihydrouridine synthase

Protein alignments

%idAln lengthE-value
MCA_06329_178.158%3800.0MCA_06329_1
A0A0J9X710_GEOCN78.133%3750.0Similar to Saccharomyces cerevisiae YML080W DUS1 Dihydrouridine synthase OS=Geotrichum candidum GN=BN980_GECA04s02067g PE=4 SV=1
A0A060SX84_BLAAD70.292%3770.0ARAD1A07304p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07304g PE=4 SV=1
Q6CDS7_YARLI67.098%3860.0YALI0B21516p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B21516g PE=4 SV=1
A0A167E9N2_9ASCO68.421%3800.0Dus1p OS=Sugiyamaella lignohabitans GN=DUS1 PE=4 SV=1
A0A1E3PJF2_9ASCO63.265%3920.0Dus-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_70018 PE=4 SV=1
A0A1D8PIH5_CANAL62.865%3779.71e-177tRNA dihydrouridine synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1404 PE=4 SV=1
DUS1_YEAST63.802%3842.83e-176tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DUS1 PE=1 SV=1
UniRef50_P5375963.802%3846.77e-173tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)] n=63 Tax=Ascomycota TaxID=4890 RepID=DUS1_YEAST
A0A1E4TGH3_9ASCO57.672%3782.70e-153Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_148099 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0831

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 422

Detailed signature matches

  1. Family IPR001269
    tRNA-dihydrouridine synthase
    1. PF01207 (Dus)
  2. Domain IPR013785
    Aldolase-type TIM barrel
    1. G3DSA:3.20.20.70
  3. Domain IPR035587
    DUS-like, FMN-binding domain
    1. cd02801 (DUS_like_FMN)
  4. SITE IPR018517
    tRNA-dihydrouridine synthase, conserved site
    1. PS01136 (UPF0034)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF51395 (FMN-linke...)
  2. mobidb-lite (disord...)

Residue annotation

  1. FMN binding site c...
  2. active site cd02801
  3. catalytic residues...
  4. substrate binding ...

Protein sequence

>MIA_03312_1
MAESLPEKTTKLTGRELYKQIGSPKTVVAPMVDQSELAWRILSRRYGADLCYTPMYHARLFATSEQYRADMFGEGDGDPA
TDRPLVVQFCANKPEELLAAARLVEDRCDAVDLNLGCPQGIAKRGHYGSFLMEDWDLIYNLINILHKELKIPVTAKIRIY
NDREKTLAYAKHVLSAGAQFLTVHGRTRDMKGQMTGIADWSMIRYLRDNLPPDTVMIANGNLLYQEDIDRSLHANNVDAV
MSAEGNLYNPAIFNSVYHKIDERFPRVDKLLREYFEIVKTTPGNASRIAMKSHFFKLMHAFLPNHTDIRAKLGSLRKYEL
EEFEKIVAEVEATVEGILAPGVEDIVVENENLEDWGGSYKNIPYWRCQPYFRTVNGVKSNGKRVSEEALESRKKKKDEKQ
EKNAPLAEEKSEEKKLEETVKA

GO term prediction

Biological Process

GO:0008033 tRNA processing
GO:0055114 oxidation-reduction process

Molecular Function

GO:0003824 catalytic activity
GO:0017150 tRNA dihydrouridine synthase activity
GO:0050660 flavin adenine dinucleotide binding

Cellular Component

None predicted.