Protein

MIA_03260_1

Length
172 amino acids


Browser: contig04:704052-704618+

Protein function

EGGNOG:0PPYBPGUG_03980Mitochondrial import receptor subunit Tom20
SGD closest match:S000003314TOM20Mitochondrial import receptor subunit TOM20
CGD closest match:CAL0000187425TOM20Tom20p

Protein alignments

%idAln lengthE-value
MCA_03870_162.092%1538.25e-56MCA_03870_1
A0A0J9X2L3_GEOCN56.364%1654.58e-50Similar to Saccharomyces cerevisiae YGR082W TOM20 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all mitochondrially proteins OS=Geotrichum candidum GN=BN980_GECA01s03585g PE=3 SV=1
UniRef50_A0A0J9X2L356.364%1659.37e-47Similar to Saccharomyces cerevisiae YGR082W TOM20 Component of the TOM (Translocase of outer membrane) complex responsible for recognition and initial import steps for all mitochondrially proteins n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X2L3_GEOCN
Q6CHM8_YARLI50.625%1603.06e-38YALI0A07084p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A07084g PE=3 SV=1
A0A1E3PKY6_9ASCO42.763%1522.16e-35Protein import receptor MAS20 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_51361 PE=3 SV=1
Q5AIA0_CANAL38.194%1441.47e-32Tom20p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOM20 PE=3 SV=1
TOM20_YEAST38.816%1524.23e-28Mitochondrial import receptor subunit TOM20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM20 PE=1 SV=1
A0A1E4TBD7_9ASCO40.741%1351.52e-26Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_53407 PE=3 SV=1
A0A060T8K7_BLAAD56.250%807.85e-26ARAD1C29524p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C29524g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1095

Protein family membership

Domains and repeats

1 20 40 60 80 100 120 140 160 172

Detailed signature matches

    1. PR00351 (OM20RECEPTOR)
    2. PF02064 (MAS20)
    1. SSF47157 (Mitochond...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_03260_1
MPSTATVVTSALAVSAVSYLIYFDYQRRHNPDFRRALRKREQKYLKQKELQAEAKQKDLKQRIEKALRDSLANEPIPSDM
ASREKYFVAEVGRADELLQAGGDPVETALAFYRALCVYPNPIDLMSIYDKSIKPPVLDILRQMVIIEPPSVLKDVLGSAI
PTGASASTITVE

GO term prediction

Biological Process

GO:0006605 protein targeting
GO:0006886 intracellular protein transport

Molecular Function

None predicted.

Cellular Component

GO:0005742 mitochondrial outer membrane translocase complex