Protein

MIA_03146_1

Length
166 amino acids


Browser: contig04:336652-337153+

Protein function

SGD closest match:S000000354TBS1Uncharacterized transcriptional regulatory protein TBS1
CGD closest match:CAL0000177698WAR1Transcriptional regulator WAR1

Protein alignments

%idAln lengthE-value
MCA_01062_172.549%511.92e-23MCA_01062_1
A0A060TCE2_BLAAD64.286%566.02e-21ARAD1D41074p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D41074g PE=4 SV=1
UniRef50_A0A060TCE264.286%561.49e-17ARAD1D41074p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060TCE2_BLAAD
A0A0J9XDU8_GEOCN66.038%531.51e-20Similar to Saccharomyces cerevisiae YML076C WAR1 Homodimeric Zn2Cys6 zinc finger transcription factor OS=Geotrichum candidum GN=BN980_GECA11s02562g PE=4 SV=1
A0A167E1N1_9ASCO55.769%527.91e-16War1p OS=Sugiyamaella lignohabitans GN=WAR1 PE=4 SV=1
A0A1E3PED6_9ASCO56.863%512.46e-15Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84457 PE=4 SV=1
Q6C6C1_YARLI43.137%519.52e-12YALI0E10681p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E10681g PE=4 SV=1
WAR1_CANAL42.188%641.21e-10Transcriptional regulator WAR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=WAR1 PE=1 SV=2
A0A1E4TCE9_9ASCO42.000%508.88e-10Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_4061 PE=4 SV=1
TBS1_YEAST39.623%532.22e-07Uncharacterized transcriptional regulatory protein TBS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TBS1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0041

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 166

Detailed signature matches

    1. PF00172 (Zn_clus)
    2. PS00463 (ZN2_CY6_FU...)
    3. SM00066 (gal4_2)
    4. SSF57701 (Zn2/Cys6 ...)
    5. PS50048 (ZN2_CY6_FU...)
    6. cd00067 (GAL4)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. DNA binding site c...
  2. Zn2+ binding site ...

Protein sequence

>MIA_03146_1
MYSAEPHQHHAFTTGLTGSDGSLVKQQQNNEQGVRPGVTSPGISDRTATSTDDSETVSPPPHLSKIHDEMVQAPKPRGRP
PGSTNSVSKPFILVSGNGQVTGNVAGSGPGVGPRRAKACEYCRSLKVRCIPRDESRPTDPCVRCVKAKRDCIFHLGPRRR
NRRTDK

GO term prediction

Biological Process

GO:0006355 regulation of transcription, DNA-templated

Molecular Function

GO:0000981 RNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0008270 zinc ion binding

Cellular Component

GO:0005634 nucleus