Protein
MIA_03118_1
Length
377 amino acids
Browser: contig04:276171-277360-
Protein function
EGGNOG: | 0PG99 | HUT1 | May be involved in specific transport of UDP-Gal from the cytosol to the Golgi lumen. Involved in the maintenance of optimal conditions for the folding of secretory pathway proteins in the endoplasmic reticulum |
---|---|---|---|
SGD closest match: | S000006165 | HUT1 | UDP-galactose transporter homolog 1 |
CGD closest match: | CAL0000194078 | HUT1 | UDP-galactose transporter homolog 1 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_03062_1 | 55.946% | 370 | 5.28e-112 | MCA_03062_1 |
A0A0J9XE37_GEOCN | 52.568% | 331 | 4.86e-98 | Similar to Saccharomyces cerevisiae YPL244C HUT1 Protein with a role in UDP-galactose transport to the Golgi lumen OS=Geotrichum candidum GN=BN980_GECA11s02837g PE=4 SV=1 |
A0A167D5V7_9ASCO | 49.848% | 329 | 8.53e-89 | Hut1p OS=Sugiyamaella lignohabitans GN=HUT1 PE=4 SV=1 |
HUT1_YARLI | 48.563% | 348 | 2.76e-88 | UDP-galactose transporter homolog 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HUT1 PE=3 SV=1 |
UniRef50_Q6C4X5 | 48.563% | 348 | 6.38e-85 | UDP-galactose transporter homolog 1 n=5 Tax=Saccharomycetales TaxID=4892 RepID=HUT1_YARLI |
A0A060T1W1_BLAAD | 42.241% | 348 | 2.07e-79 | ARAD1C27478p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C27478g PE=4 SV=1 |
A0A1E3PH67_9ASCO | 44.242% | 330 | 1.42e-65 | UAA transporter OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52364 PE=4 SV=1 |
HUT1_CANAL | 38.082% | 365 | 3.69e-59 | UDP-galactose transporter homolog 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HUT1 PE=3 SV=1 |
HUT1_YEAST | 34.431% | 334 | 9.45e-41 | UDP-galactose transporter homolog 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HUT1 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0243
Protein family membership
- UAA transporter (IPR013657)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PF08449 (UAA)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
SSF103481 (Multidru...)
-
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_03118_1 MDTKTITCEKDAQTVTVEPSPGPSPTKGSVADLLFSVAGIYASFLTWALLQERISATGYGAQAEIYRGSLVINAVQALLA MAVGFVYASVKAPRARGGESPLAVFSGNAALRRELLTVAATQTLAAPLGYAALRHVSYLTLLLAKSCKLVPVMLIHLTVY RRSFPVYKYAVVFAITAGVFMFTYYKAASKTSHAVVAGAAGSSWVGLGLVGLNLVLDGVTNSTQDHIFHKHKQMTGPRMM FGLNLAVCLLTGAYLVGSALALRGGVPGAWLYSDQLAMTAGFVARNGPRVLVDTALFGLCGALGQVFIFHTLETYGSLIL VTVTVTRKMVSMLLSVVWFNHSLTVGQWVGVGAVFGGIGAEAAFKYWQTRQKQVKKD
GO term prediction
Biological Process
GO:0055085 transmembrane transport
Molecular Function
None predicted.
Cellular Component
None predicted.