Protein

MIA_03112_1

Length
143 amino acids


Browser: contig04:271370-271936-

Protein function

EGGNOG:0PPSMFG07257.1mitochondrial 54S ribosomal protein MNP1
SGD closest match:S000003036MNP154S ribosomal protein L12, mitochondrial
CGD closest match:CAL0000177740orf19.2275Mitochondrial nucleoid protein

Protein alignments

%idAln lengthE-value
A0A0J9X5B7_GEOCN62.222%1352.04e-31Similar to Saccharomyces cerevisiae YGL068W MNP1 Protein associated with the mitochondrial nucleoid OS=Geotrichum candidum GN=BN980_GECA03s00505g PE=3 SV=1
MCA_03084_163.566%1297.35e-31MCA_03084_1
A0A1E3PFA5_9ASCO58.730%1267.62e-30ClpS-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47819 PE=3 SV=1
A0A060T5Q9_BLAAD55.118%1278.10e-26ARAD1B05962p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B05962g PE=3 SV=1
Q59Z25_CANAL54.135%1333.54e-24Mitochondrial nucleoid protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.2275 PE=3 SV=1
UniRef50_B9WC0549.655%1451.64e-20Mitochondrial ribosomal protein, putative n=26 Tax=Eukaryota TaxID=2759 RepID=B9WC05_CANDC
A0A167DBK2_9ASCO52.239%1342.09e-23Mitochondrial nucleoid protein MNP1 OS=Sugiyamaella lignohabitans GN=MNP1 PE=3 SV=1
MNP1_YEAST78.431%512.77e-2054S ribosomal protein L12, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MNP1 PE=1 SV=1
Q6C1C1_YARLI48.000%1252.83e-19YALI0F17556p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F17556g PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9895
Predicted cleavage: 32

Protein family membership

Domains and repeats

1 20 40 60 80 100 120 143

Detailed signature matches

    1. cd00387 (Ribosomal_...)
    1. SSF54736 (ClpS-like)
    1. PF00542 (Ribosomal_L12)
Unintegrated signatures no IPR
Unintegrated signatures

Residue annotation

  1. core dimer interfa...
  2. peripheral dimer i...
  3. L11 interface cd00...
  4. putative EF-G inte...
  5. putative EF-Tu int...

Protein sequence

>MIA_03112_1
MSAVLRLSARSLAASSVRRAIVPTLACARRFNSTEAAAPVDPKIAAIVDSISTLTLLETAALEAPAEEAPKEKTMFTLKL
ESFDPKSKPKIIKEVKSLLGLSLVESKKFVEAAPKVLKENVVKEDAEKIKAAIEAAGGKISLD

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome