Protein

MIA_03024_1

Length
308 amino acids


Browser: contig04:45266-46193-

Protein function

EGGNOG:0PKGRFG03667.1Catechol dioxygenase
CGD closest match:CAL0000188195HQD2Catechol 1,2-dioxygenase

Protein alignments

%idAln lengthE-value
MCA_00701_182.68%3060.0MCA_00701_1
A0A167DF12_9ASCO69.58%3096e-156Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_1116 PE=4 SV=1
HQD2_CANAL55.52%2993e-123Catechol 1,2-dioxygenase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HQD2 PE=1 SV=1
UniRef50_P8602955.52%2997e-120Catechol 1,2-dioxygenase n=25 Tax=saccharomyceta TaxID=716545 RepID=HQD2_CANAL
A0A060T9I8_BLAAD38.74%2537e-59ARAD1D18458p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D18458g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0655

Protein family membership

None predicted.

Domains and repeats

1 50 100 150 200 250 308

Detailed signature matches

    1. SSF49482 (Aromatic ...)
    1. PF04444 (Dioxygenase_N)
    1. PS00083 (INTRADIOL_...)
    2. PF00775 (Dioxygenase_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd03461 (1,2-HQD)

Residue annotation

  1. dimer interface cd...
  2. active site cd03461

Protein sequence

>MIA_03024_1
MDQQFTEMVIAAMGPKTTPKMRRILGSLIQHIHDFSRENQITVEEWMAGVEFINRIGQMSDERRNEGILVSDVFGLESLV
DSITYHLEAHDHTSTAIIGPFYRPNSPKYAYGQSIIQKELGGQKTWVHGRVTDTAGNPLEGAELEVWHTAPNGLYEQQDP
EQPDYNLRGTFTADENGDYAYIALRPTNYPIPYDGPAGDLLQLMDRHPYRPSHIHWRVTKPGFRSLITQIYDSDCEYVKN
DSVFAVKPELVVHFKPASAEIKSKYGVEFDLEYNIALPTEAQAHAQVEKRLAEQKALEEELHAKAQLK

GO term prediction

Biological Process

GO:0006725 cellular aromatic compound metabolic process
GO:0009712 catechol-containing compound metabolic process
GO:0055114 oxidation-reduction process

Molecular Function

GO:0003824 catalytic activity
GO:0005506 iron ion binding
GO:0008199 ferric iron binding
GO:0016702 oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
GO:0018576 catechol 1,2-dioxygenase activity

Cellular Component

None predicted.