Protein

MIA_02992_1

Length
406 amino acids


Browser: contig03:2279244-2280465+

Protein function

EGGNOG:0PNDSPGUG_04184General stress response protein Whi2
SGD closest match:S000005569WHI2Growth regulation protein
CGD closest match:CAL0000178381orf19.7036Uncharacterized protein

Protein alignments

%idAln lengthE-value
MCA_02631_147.619%3991.52e-110MCA_02631_1
A0A0J9XFK9_GEOCN50.249%2013.48e-59Similar to Saccharomyces cerevisiae YOR043W WHI2 Protein required, with binding partner Psr1p, for full activation of the general stress response, possibly through Msn2p dephosphorylation OS=Geotrichum candidum GN=BN980_GECA12s01022g PE=4 SV=1
UniRef50_A0A0J9XFK950.249%2017.11e-56Similar to Saccharomyces cerevisiae YOR043W WHI2 Protein required, with binding partner Psr1p, for full activation of the general stress response, possibly through Msn2p dephosphorylation n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XFK9_GEOCN
A0A060T2R6_BLAAD44.712%2084.13e-53ARAD1C30415p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C30415g PE=4 SV=1
Q6CHQ6_YARLI38.866%2471.05e-50YALI0A06369p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A06369g PE=4 SV=1
A0A1E3PPU9_9ASCO38.500%2001.26e-46Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_45458 PE=4 SV=1
A0A161HIG4_9ASCO32.313%2944.66e-45Whi2p OS=Sugiyamaella lignohabitans GN=WHI2 PE=4 SV=1
A0A1D8PQP1_CANAL30.172%2321.91e-29Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.7036 PE=4 SV=1
A0A1E4TAJ5_9ASCO30.392%2042.00e-19Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_3447 PE=4 SV=1
WHI2_YEAST24.800%2501.58e-17Growth regulation protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=WHI2 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0071

Protein family membership

None predicted.

Domains and repeats

None predicted.

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_02992_1
MSLPAATAEPVPPASILTQVDESAGYQPSWTNDGASSSADAQEAQDNSSRKFVINARGTLIELTQHEMYRLPQCILVGLS
SSIVTGAPTLDSGDPSNPLYINFPPRFLQYTLDVFRAMSNESPRNSLSTLEMTDLAEAIRTKPAVIVLREDVDFYCLPPS
ESVTKREMNSIKRACGQLLVQRNKVLAGLRKSELPGSPEQHLIEMLCSTGFSPDETWGYREMEPNKTVVSSLALVRLRTD
LLPVENHQKPQDYTERGNPYADDDEGSVAQMSIDQIEDPPVVSESDETPATSVTSAEVPDTVSPTTSHESHESQESQESH
ETHDSAAGTIREEGAKSGETSEKPAQQTQQQPAVDLAKSQKLFLFWKKPARKCWWDTITFSDVPGCDVPIKVHLRSVWTL
ELCIVD

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.