Protein
MIA_02899_1
Length
268 amino acids
Browser: contig03:2050142-2050949-
Protein function
| EGGNOG: | 0PGKS | PRE4 | The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity) |
|---|---|---|---|
| SGD closest match: | S000001946 | PRE4 | Proteasome subunit beta type-7 |
| CGD closest match: | CAL0000179123 | orf19.4230 | Proteasome subunit beta |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_02645_1 | 69.888% | 269 | 3.97e-134 | MCA_02645_1 |
| A0A1E3PEL6_9ASCO | 70.455% | 264 | 4.89e-128 | Proteasome subunit beta OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84475 PE=3 SV=1 |
| A0A0J9XHV5_GEOCN | 69.888% | 269 | 5.25e-128 | Proteasome subunit beta OS=Geotrichum candidum GN=BN980_GECA18s00780g PE=3 SV=1 |
| A0A060T507_BLAAD | 60.584% | 274 | 5.51e-113 | Proteasome subunit beta OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C07678g PE=3 SV=1 |
| UniRef50_A0A1W5CRL2 | 59.701% | 268 | 2.52e-98 | 20s proteasome subunit beta 7 n=1 Tax=Umbilicaria pustulata TaxID=136370 RepID=A0A1W5CRL2_9LECA |
| Q6C3S4_YARLI | 60.377% | 265 | 1.01e-99 | Proteasome subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E32505g PE=3 SV=1 |
| A0A1E4TK31_9ASCO | 54.789% | 261 | 1.91e-92 | Proteasome subunit beta OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_82607 PE=3 SV=1 |
| A0A1D8PNC8_CANAL | 52.330% | 279 | 4.48e-90 | Proteasome subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4230 PE=3 SV=1 |
| PSB7_YEAST | 55.351% | 271 | 2.63e-89 | Proteasome subunit beta type-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE4 PE=1 SV=1 |
| A0A167D7T9_9ASCO | 67.969% | 128 | 2.79e-57 | Proteasome core particle subunit beta 7 OS=Sugiyamaella lignohabitans GN=PRE4 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0675
Protein family membership
- Proteasome, subunit alpha/beta (IPR001353)
- Proteasome B-type subunit (IPR023333)
- Proteasome endopeptidase complex, beta subunit (IPR016295)
- Proteasome B-type subunit (IPR023333)
Domains and repeats
-
Domain
1
50
100
150
200
268
Detailed signature matches
Residue annotation
-
active site cd03760
-
beta subunit inter...
Protein sequence
>MIA_02899_1 MDHFQTNWGRPRDDIYGSYDKRIHEASDAAAAANIPTTNTQAPIVTGTSVIAIKFNKGVIIAADNLASYGSLARFTDVER LLPVGRDTVVGVGGDISDYQYLQRMLEQLEINDNYDNDGFELTASNIFHYISNVMYNRRSRMNPLWNAIVVAGVDPATKE PFLSTVDLRGVTYSAPTLATGFGAYLAVPLLRQLVDDEKDVAKVTEEEARKMIDTCMKVLFYRDARSLDKYSVATITAEG VKFDKNVRPENMNWNFAGGIKGYGTQDE
GO term prediction
Biological Process
GO:0051603 proteolysis involved in cellular protein catabolic process
Molecular Function
GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity
Cellular Component
GO:0005839 proteasome core complex