Protein

MIA_02885_1

Length
271 amino acids

Browser: contig03:2003415-2004231+

Protein function

EGGNOG:0PH45PUP1The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000005683PUP1Proteasome subunit beta type-2
CGD closest match:CAL0000181985PUP1Proteasome core particle subunit beta 2

Protein alignments

%idAln lengthE-value
MCA_02534_184.191%2728.49e-173MCA_02534_1
A0A0J9XJM1_GEOCN81.481%2704.26e-165Similar to Saccharomyces cerevisiae YOR157C PUP1 Beta 2 subunit of the 20S proteasome OS=Geotrichum candidum GN=BN980_GECA24s00362g PE=4 SV=1
A0A167D368_9ASCO75.556%2707.73e-159Proteasome core particle subunit beta 2 OS=Sugiyamaella lignohabitans GN=PUP1 PE=4 SV=1
A0A1E3PJQ0_9ASCO74.815%2701.63e-154Endopeptidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50813 PE=4 SV=1
A0A060T2V3_BLAAD72.593%2704.23e-149ARAD1A03674p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A03674g PE=4 SV=1
Q6C950_YARLI77.470%2531.87e-148YALI0D14058p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D14058g PE=4 SV=1
A0A1E4TIV4_9ASCO69.004%2712.18e-141Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_74019 PE=4 SV=1
PSB2_YEAST73.413%2528.16e-140Proteasome subunit beta type-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUP1 PE=1 SV=1
UniRef50_P2504373.413%2521.95e-136Proteasome subunit beta type-2 n=101 Tax=Eukaryota TaxID=2759 RepID=PSB2_YEAST
A0A1D8PU67_CANAL67.778%2701.81e-138Proteasome core particle subunit beta 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PUP1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0805

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 271

Detailed signature matches

  1. Family IPR001353
    Proteasome, subunit alpha/beta
    1. PF00227 (Proteasome)
  2. Family IPR023333
    Proteasome B-type subunit
    1. PS51476 (PROTEASOME...)
  3. Family IPR000243
    Peptidase T1A, proteasome beta-subunit
    1. PR00141 (PROTEASOME)
  4. Domain IPR029055
    Nucleophile aminohydrolases, N-terminal
    1. G3DSA:3.60.20.10
    2. SSF56235 (N-termina...)
  5. Domain IPR024689
    Proteasome beta subunit, C-terminal
    1. PF12465 (Pr_beta_C)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd03763 (proteasome...)

Residue annotation

  1. active site cd03763
  2. beta subunit inter...

Protein sequence

>MIA_02885_1
MPGLSFDNHLRNNYLEANGVAVPKATSTGTTIVGCKFNGGVVIAADTRATAGPIVADKNCEKLHQISPHIWCAGAGTAAD
TEMVTQLISSNIELHGLNTGRQPRVVTALTMLKQHLFQYQGHIGAYLIVAGVDPTGPHLFSIHAHGSTDVGYYLSLGSGS
MAAMAVLEARWHKDISKQEAIELVADAIESGIWNDLGSGSNVDICVMEQDQPAQLHRGFRKPNERGKKERSYKFARGTTG
ILSQSIRDIVSVVDVPLTTTVGGPDAMDIDG

GO term prediction

Biological Process

GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex