Protein

MIA_02798_1

Length
296 amino acids


Browser: contig03:1786522-1787463+

Protein function

EGGNOG:0PK0SATP10F1F0 ATP synthase assembly protein Atp10
SGD closest match:S000004385ATP10Mitochondrial ATPase complex subunit ATP10
CGD closest match:CAL0000187289CAALFM_CR08130WAUncharacterized protein

Protein alignments

%idAln lengthE-value
MCA_05499_159.600%2502.71e-107MCA_05499_1
A0A0J9XGE7_GEOCN54.086%2571.45e-96Similar to Saccharomyces cerevisiae YLR393W ATP10 Mitochondrial inner membrane protein required for assembly of the F0 sector of mitochondrial F1F0 ATP synthase OS=Geotrichum candidum GN=BN980_GECA15s00637g PE=4 SV=1
UniRef50_A0A0J9XGE754.086%2572.96e-93Similar to Saccharomyces cerevisiae YLR393W ATP10 Mitochondrial inner membrane protein required for assembly of the F0 sector of mitochondrial F1F0 ATP synthase n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XGE7_GEOCN
A0A167C7V5_9ASCO47.390%2495.23e-83Atp10p OS=Sugiyamaella lignohabitans GN=ATP10 PE=4 SV=1
A0A060T806_BLAAD42.529%2611.97e-66ARAD1C32450p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C32450g PE=4 SV=1
Q6C127_YARLI38.686%2741.98e-57YALI0F19756p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F19756g PE=4 SV=1
A0A1E4TGQ1_9ASCO36.546%2495.44e-49Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_113191 PE=4 SV=1
A0A1E3PFJ7_9ASCO32.841%2714.73e-43Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_67339 PE=4 SV=1
Q5A390_CANAL28.938%2731.10e-39Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAALFM_CR08130WA PE=4 SV=1
ATP10_YEAST30.303%2649.34e-38Mitochondrial ATPase complex subunit ATP10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ATP10 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9864
Predicted cleavage: 55

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. PF05176 (ATP-synt_10)

Protein sequence

>MIA_02798_1
MVLRSLATRPVLGINSTLWASQSTALRAISSKAATKRVAAAPLTRPIGDEKVPLVTDNTGVDTRTRAQKKADFTNYERHL
ARRRELTAEISKSQFAEIYSFRDTFGKAWLAPKAYFRSDKALYMPNFCGRTLTNPDQRGTTATLAGKLSIVRVFTAITGE
RQADSYFYVPSGTPENHDTLHAAAVSVPEDGFQVVDINIPENFAKELIVKLFIGKIKNQFPNPDRANRYFIANRKGVSKE
LKAAIHLENKYAGYVYVVDKDCKIRWAACGHALDEERDSLWRIIASLKKEQTATSV

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.