Protein

MIA_02778_1

Length
277 amino acids

Browser: contig03:1736201-1737035+

Protein function

EGGNOG:0PNDYPGUG_03071Superoxide dismutase
SGD closest match:S000003862RSM2637S ribosomal protein S26, mitochondrial
CGD closest match:CAL0000186555orf19.3938Mitochondrial 37S ribosomal protein RSM26

Protein alignments

%idAln lengthE-value
MCA_01515_157.540%2522.75e-97MCA_01515_1
A0A0J9X482_GEOCN53.226%2489.14e-83Similar to Saccharomyces cerevisiae YJR101W RSM26 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA02s03233g PE=4 SV=1
UniRef50_A0A0J9X48253.226%2481.87e-79Similar to Saccharomyces cerevisiae YJR101W RSM26 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X482_GEOCN
A0A060T3G4_BLAAD46.429%2523.62e-69ARAD1C33154p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C33154g PE=4 SV=1
A0A167DUT9_9ASCO44.400%2505.81e-67Mitochondrial 37S ribosomal protein RSM26 OS=Sugiyamaella lignohabitans GN=RSM26 PE=4 SV=1
A0A1E3PT79_9ASCO43.600%2501.43e-63Manganese and iron superoxide dismutase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_54409 PE=4 SV=1
Q6CEC5_YARLI38.956%2498.60e-56YALI0B16742p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B16742g PE=4 SV=1
RT26_YEAST38.996%2591.65e-5437S ribosomal protein S26, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM26 PE=1 SV=1
Q5AK82_CANAL36.290%2481.32e-47Mitochondrial 37S ribosomal protein RSM26 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.3938 PE=4 SV=1
A0A1E4TM31_9ASCO35.000%2609.66e-43Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30851 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9996
Predicted cleavage: 14

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 277

Detailed signature matches

  1. Domain IPR019831
    Manganese/iron superoxide dismutase, N-terminal
    1. SSF46609 (Fe,Mn sup...)
  2. Domain IPR019832
    Manganese/iron superoxide dismutase, C-terminal
    1. PF02777 (Sod_Fe_C)
    2. SSF54719 (Fe,Mn sup...)

Protein sequence

>MIA_02778_1
MISRALRSSCRASAKAASFASRQSQLSRRSIHNIPILANQTTYQQQGIRGLYSKEGFRDVWTEYQQYLVDELSRETAETE
HETRTPFGIMLNTATTQLDTPIFNFASQAHNNHLFVEALNPSEDADGTPIVNQTRPSAKLLEAIQLYFEDLDTLKADMIE
LATLPENLAPGWVFLVEGDDKSLYLTYAFSAGSPYFAGRSQAFDLNTPMTKEVEETLDSIQMDVLEKAPTYNMPLIAINC
WDVAYITDYTVAGREAFIENVWKSLNWDVINKRFYGN

GO term prediction

Biological Process

GO:0006801 superoxide metabolic process
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004784 superoxide dismutase activity
GO:0046872 metal ion binding

Cellular Component

None predicted.