Protein

MIA_02773_1

Length
369 amino acids


Browser: contig03:1725006-1726116-

Protein function

EGGNOG:0PM3NFG05070.1conserved hypothetical protein
SGD closest match:S000002342YDL183CUncharacterized protein YDL183C
CGD closest match:CAL0000197826orf19.1676Uncharacterized protein

Protein alignments

%idAln lengthE-value
A0A0J9X798_GEOCN32.520%3692.28e-50Similar to Saccharomyces cerevisiae YDL183C MKR1 Mitochondrial inner-membrane protein thought to be involved in the formation of an active mitochondrial K+/H+ exchanger (KHE) system OS=Geotrichum candidum GN=BN980_GECA04s03585g PE=4 SV=1
UniRef50_A0A0J9X79832.520%3694.66e-47Similar to Saccharomyces cerevisiae YDL183C MKR1 Mitochondrial inner-membrane protein thought to be involved in the formation of an active mitochondrial K+/H+ exchanger (KHE) system n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X798_GEOCN
MCA_05393_133.140%3441.12e-38MCA_05393_1
Q6C9B6_YARLI37.849%2512.59e-34YALI0D12474p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D12474g PE=4 SV=1
A0A060T2V2_BLAAD37.879%1985.46e-28ARAD1C31658p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C31658g PE=4 SV=1
A0A167FU25_9ASCO36.410%1951.19e-26Uncharacterized protein OS=Sugiyamaella lignohabitans GN=AWJ20_3343 PE=4 SV=1
A0A1E3PJY6_9ASCO31.987%2974.95e-26Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_82718 PE=4 SV=1
A0A1D8PJ88_CANAL29.452%2924.28e-23Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1676 PE=4 SV=1
YD183_YEAST30.686%2777.90e-21Uncharacterized protein YDL183C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDL183C PE=4 SV=1
A0A1E4TJD8_9ASCO29.648%1992.86e-16Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_78384 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.6053
Predicted cleavage: 12

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 369

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_02773_1
MRFIVLPVSSRAVYVHCVNHNLPTIISSPAAKSVLALDPTLLSRVAHADRASEATPTSAALEAALTESSHADHGVTVPAR
KTPRLDDRIVARAAKLWASFEESQTPWKRKLVKAINSLLERIPYEEAELRAVPSKSAVLRKLRELEQEKASAAAATESSK
AADDKHDLAKSHVSYEEPAGQVPTHMHPISVYYPASSITPQQAFAQLRELAHTGRTLHLRRMLTCLALAPLTLPVAMLPV
IPNVPGIYLMYRAWCHFKALEGARHLQLLVEGEAEDGNTSEGQILAHLNFKPCEQLDLVYRERAARRDDGGIIKFGEEGP
EKLVLEDETTVKPIEFLVEAHNTPSNLHSELLKAIHQTRKKLENNHDSK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.