Protein

MIA_02725_1

Length
139 amino acids


Browser: contig03:1556578-1557145-

Protein function

EGGNOG:0PMX7MMS2ubiquitin-conjugating enzyme
SGD closest match:S000003055MMS2Ubiquitin-conjugating enzyme variant MMS2
CGD closest match:CAL0000191589orf19.6358E2 ubiquitin-conjugating protein

Protein alignments

%idAln lengthE-value
MCA_03094_181.159%1384.21e-74MCA_03094_1
A0A0J9X6D9_GEOCN80.576%1392.45e-72Similar to Saccharomyces cerevisiae YGL087C MMS2 Ubiquitin-conjugating enzyme variant involved in error-free postreplication repair OS=Geotrichum candidum GN=BN980_GECA03s07468g PE=3 SV=1
A0A060T6E2_BLAAD78.102%1377.88e-67ARAD1C19008p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C19008g PE=3 SV=1
UniRef50_Q5B73665.942%1382.11e-56Protein involved in error-free postreplication DNA repair (Eurofung) n=97 Tax=Fungi TaxID=4751 RepID=Q5B736_EMENI
MMS2_YEAST67.647%1362.58e-54Ubiquitin-conjugating enzyme variant MMS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MMS2 PE=1 SV=1
A0A1E4TJ82_9ASCO63.309%1392.46e-54Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_30119 PE=3 SV=1
A0A167DQU5_9ASCO74.257%1016.95e-54E2 ubiquitin-conjugating protein MMS2 OS=Sugiyamaella lignohabitans GN=MMS2 PE=3 SV=1
Q6C453_YARLI68.317%1016.88e-51YALI0E29601p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E29601g PE=3 SV=1
A0A1D8PFF9_CANAL63.971%1361.81e-49E2 ubiquitin-conjugating protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6358 PE=3 SV=1
A0A1E3PI63_9ASCO32.990%974.66e-09Ubiquitin conjugating enzyme OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_70496 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1549

Protein family membership

None predicted.

Domains and repeats

1 20 40 60 80 100 120 139

Detailed signature matches

    1. SSF54495 (UBC-like)
    1. PS50127 (UBIQUITIN_...)
    2. PF00179 (UQ_con)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SM00212 (ubc_7)

Protein sequence

>MIA_02725_1
MSVQIPRSFRLLEELEKGEKGLGSEACSLGLADGDDIDMRYWNGTILGPPHSTHENRIYCLSLEAGPEYPNKPPSVKFIS
KINIPCVNSTTGIVDPSKVPCLANWKRSYTMENVLLDLRHEMASSTNRKLSQPPEGTTF

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.