Protein

MIA_02640_1

Length
526 amino acids

Browser: contig03:1322018-1323599-

Protein function

EGGNOG:0PHS2GPA1guanine nucleotide-binding protein
SGD closest match:S000001047GPA1Guanine nucleotide-binding protein alpha-1 subunit
CGD closest match:CAL0000174954CAG1Guanine nucleotide-binding protein subunit alpha

Protein alignments

%idAln lengthE-value
MCA_04172_157.588%4810.0MCA_04172_1
Q5AK05_CANAL45.455%4291.06e-130Guanine nucleotide-binding protein subunit alpha OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CAG1 PE=4 SV=1
A0A1E3PIQ5_9ASCO44.222%4501.62e-123Guanine nucleotide binding protein, alpha subunit OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_71145 PE=4 SV=1
UniRef50_A0A1E3PIQ544.222%4504.38e-120Guanine nucleotide binding protein, alpha subunit n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PIQ5_9ASCO
GPA1_YEAST43.384%4612.00e-121Guanine nucleotide-binding protein alpha-1 subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPA1 PE=1 SV=3
A0A167DPQ7_9ASCO45.000%4208.87e-117Guanine nucleotide-binding protein subunit alpha OS=Sugiyamaella lignohabitans GN=GPA1 PE=4 SV=1
A0A060TB66_BLAAD43.953%4303.32e-115ARAD1D25520p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D25520g PE=4 SV=1
Q6C684_YARLI42.579%4112.18e-107YALI0E11627p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E11627g PE=4 SV=1
A0A0J9X738_GEOCN59.438%2495.96e-97Similar to Saccharomyces cerevisiae YHR005C GPA1 GTP-binding alpha subunit of the heterotrimeric G protein that couples to pheromone receptors OS=Geotrichum candidum GN=BN980_GECA04s06654g PE=4 SV=1
A0A1E4TJF5_9ASCO42.017%2382.27e-59Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_42505 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0246

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 250 300 350 400 450 500 526

Detailed signature matches

  1. Family IPR001019
    Guanine nucleotide binding protein (G-protein), alpha subunit
    1. cd00066 (G-alpha)
    2. SM00275 (galpha_1)
    3. PF00503 (G-alpha)
    4. PR00318 (GPROTEINA)
  2. Family IPR002975
    Fungal G-protein, alpha subunit
    1. PR01241 (GPROTEINAFNG)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR011025
    G protein alpha subunit, helical insertion
    1. SSF47895 (Transduci...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. mobidb-lite (disord...)

Residue annotation

  1. G1 box cd00066
  2. GTP/Mg2+ binding s...
  3. GoLoco binding sit...
  4. Switch I region cd...
  5. G2 box cd00066
  6. beta - gamma compl...
  7. adenylyl cyclase i...
  8. G3 box cd00066
  9. Switch II region c...
  10. G4 box cd00066
  11. putative receptor ...
  12. G5 box cd00066

Protein sequence

>MIA_02640_1
MGCGMSTIETDETFSSPTKSQHQMTSIAAGQRPQPSAPTTSTASIPSPALPSTPTAAAHHAPMAPSTSMGSNSGNNNSAI
SAAAARKRFQERKQWIQARNNQIEAGLSLTHNRSIRTIKLLMLGAGESGKSTVIKQIRLIHGTGFTDRERAQYTGVIWSD
AVHCMRTLITAARDLNIPLDSTDPESPLGEFNKLVMETDPAQQYDEDVTTGGQGSGVPSNGSSHNYLDDYVLKYDNRRHK
KGKSPMGQQPSQQPQSTLNNTYNEINEHQGLLEDVEGEDLQSKKKERPPTKQEVATAISKLWKNDRGIRECFKRANQFQL
EVNAEHYFENIFSYCQPGYMATDEDILKGRIKTTGINETNITIKHRAFQIIDVGGQRSERRKWIHCFDDVTAIIFVAAVS
EYDEVLFEDATMNRMAEALLLFESICNSRWFSNTCIILFLNKIDKLQEKLPISPITKYFKNYTGNPLSASEACKYFENLF
LAQNKNPRRTIYPYPTCATDTSSMKFVIGAVTKEVIHTALRDYGMI

GO term prediction

Biological Process

GO:0007165 signal transduction
GO:0007186 G-protein coupled receptor signaling pathway

Molecular Function

GO:0001664 G-protein coupled receptor binding
GO:0003924 GTPase activity
GO:0004871 signal transducer activity
GO:0005525 GTP binding
GO:0019001 guanyl nucleotide binding
GO:0031683 G-protein beta/gamma-subunit complex binding

Cellular Component

GO:0005834 heterotrimeric G-protein complex