Protein
MIA_02636_1
Length
478 amino acids
Browser: contig03:1313380-1314962-
Protein function
| EGGNOG: | 0PGAP | MDM10 | Component of the ERMES MDM complex, which serves as a molecular tether to connect the endoplasmic reticulum and mitochondria. Components of this complex are involved in the control of mitochondrial shape and protein biogenesis and may function in phospholipid exchange. mdm10 is involved in the late assembly steps of the general translocase of the mitochondrial outer membrane (TOM complex). Functions in the tom40-specific route of the assembly of outer membrane beta-barrel proteins, including the association of tom40 with the receptor tom22 and small TOM proteins. Can associate with the SAM(core) complex as well as the mdm12-mmm1 complex, both involved in late steps of the major beta-barrel assembly pathway, that is responsible for biogenesis of all outer membrane beta-barrel proteins. May act as a switch that shuttles between both complexes and channels precursor proteins into the tom40-specific pathway. Plays a role in mitochondrial morphology and in the inheritance of mitochondria (By similarity) |
|---|---|---|---|
| SGD closest match: | S000000008 | MDM10 | Mitochondrial distribution and morphology protein 10 |
| CGD closest match: | CAL0000180412 | MDM10 | Mitochondrial distribution and morphology protein 10 |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04201_1 | 56.792% | 530 | 0.0 | MCA_04201_1 |
| A0A0J9XKS8_GEOCN | 60.912% | 307 | 2.53e-142 | Mitochondrial distribution and morphology protein 10 OS=Geotrichum candidum GN=MDM10 PE=3 SV=1 |
| A0A167E3P8_9ASCO | 56.169% | 308 | 5.23e-123 | Mitochondrial distribution and morphology protein 10 OS=Sugiyamaella lignohabitans GN=MDM10 PE=3 SV=1 |
| UniRef50_A0A167E3P8 | 56.169% | 308 | 1.44e-119 | Mitochondrial distribution and morphology protein 10 n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A167E3P8_9ASCO |
| A0A1E3PGS5_9ASCO | 55.150% | 301 | 3.15e-110 | Mitochondrial distribution and morphology protein 10 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=MDM10 PE=3 SV=1 |
| A0A060SYQ1_BLAAD | 51.148% | 305 | 1.57e-103 | Mitochondrial distribution and morphology protein 10 OS=Blastobotrys adeninivorans GN=MDM10 PE=3 SV=1 |
| MDM10_YARLI | 48.525% | 305 | 2.57e-96 | Mitochondrial distribution and morphology protein 10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MDM10 PE=3 SV=1 |
| MDM10_CANAL | 40.240% | 333 | 6.54e-82 | Mitochondrial distribution and morphology protein 10 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDM10 PE=3 SV=2 |
| A0A1E4TIP5_9ASCO | 40.728% | 302 | 7.83e-65 | Mitochondrial distribution and morphology protein 10 OS=Tortispora caseinolytica NRRL Y-17796 GN=MDM10 PE=3 SV=1 |
| MDM10_YEAST | 31.789% | 475 | 2.22e-56 | Mitochondrial distribution and morphology protein 10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MDM10 PE=1 SV=5 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0335
Protein family membership
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_02636_1 MFTYMEYILKSFHKATGWNEDNIYSHFTETSDNLINFSIPKGFNVTVSSQATKNSFSSYTLSDLGFVSGSISYLYTSKPL EGIATSSEISIRDAISGYKVLEPLKRQEDPMYWEVWQNGVRVDTKDTLLYGRMFLPGNGLEAMMVRRLSPTSQLVIKSVS DSRYKNNGAMTFTYQYNDGKWTSEYIYSTHEALLGLTGTYNFGAEERMKDPSITSRLSLGGELFYAVLSKSPGISTCLRY TAQSLYTGTPLSLALLCNPLMGQISSMYSLSTRAASLGSRFDFNIYSYESDLSIGWEIWRFLDNSQEAGFSANSCHKGDS ERSSDSNSEGEPPESQDPNTLDTSPQPQGTADTDLNGDLAVYSSLPDPPYIVSAEDGYLSRKYKRFLNTVDRTLYDTGLK SVATDDPVNTPIPHTEEESIQDAPVFCFKGNTSLSKQTINLLWEGRFQELLISSGFGLSLQTKVPSVTTFGVEVQYSA
GO term prediction
Biological Process
GO:0007005 mitochondrion organization
Molecular Function
None predicted.
Cellular Component
GO:0032865 ERMES complex