Protein

MIA_02623_1

Length
270 amino acids

Browser: contig03:1285994-1287007-

Protein function

EGGNOG:0PIUYRPL2A60S ribosomal protein L2
SGD closest match:S000002104RPL2A60S ribosomal protein L2-A
CGD closest match:CAL0000174265RPL2Ribosomal 60S subunit protein L2A

Protein alignments

%idAln lengthE-value
A0A0F7RSL5_GEOCN93.651%2527.77e-163Similar to Saccharomyces cerevisiae YFR031C-A RPL2A Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA07s04597g PE=4 SV=1
A0A1E3PEU7_9ASCO90.873%2524.50e-159Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83997 PE=4 SV=1
A0A060T542_BLAAD91.270%2522.37e-158ARAD1C02926p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C02926g PE=4 SV=1
A0A1D8PF08_CANAL90.873%2522.28e-158Ribosomal 60S subunit protein L2A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL2 PE=4 SV=1
A0A167EUT2_9ASCO90.079%2526.58e-157Ribosomal 60S subunit protein L2A OS=Sugiyamaella lignohabitans GN=RPL2A PE=4 SV=1
Q6C0H1_YARLI89.683%2521.81e-155YALI0F24739p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F24739g PE=4 SV=1
RL2A_YEAST86.111%2526.61e-15460S ribosomal protein L2-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL2A PE=1 SV=1
UniRef50_P0CX4586.111%2521.58e-15060S ribosomal protein L2-A n=232 Tax=Opisthokonta TaxID=33154 RepID=RL2A_YEAST
A0A1E4TEM3_9ASCO78.571%2521.70e-137Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1939 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9970
Predicted cleavage: 41

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 270

Detailed signature matches

  1. Family IPR002171
    Ribosomal protein L2
    1. SM01383 (Ribosomal_...)
    2. PIRSF002158 (RPL2p_...)
  2. Domain IPR012340
    Nucleic acid-binding, OB-fold
    1. SSF50249 (Nucleic a...)
  3. Domain IPR022666
    Ribosomal Proteins L2, RNA binding domain
    1. PF00181 (Ribosomal_L2)
  4. Domain IPR014722
    Ribosomal protein L2 domain 2
    1. G3DSA:2.30.30.30
  5. Domain IPR008991
    Translation protein SH3-like domain
    1. SSF50104 (Translati...)
  6. Domain IPR022669
    Ribosomal protein L2, C-terminal
    1. PF03947 (Ribosomal_...)
    2. SM01382 (Ribosomal_...)
  7. Domain IPR014726
    Ribosomal protein L2, domain 3
    1. G3DSA:4.10.95...
  8. SITE IPR022671
    Ribosomal protein L2, conserved site
    1. PS00467 (RIBOSOMAL_L2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:2.40.50...

Protein sequence

>MIA_02623_1
MKCLGRSRQYFNPDTNIRRVIRNQRKGAGSIFTSHTRLRKGAAKLRKLDYVEREGYIRGVVKQIVHDPGRGAPLAKVVFR
DPYKYKLREETFIANEGIYTGQFIYAGAKASLNVGNILPLGSVPEGTILSNVEEKPGDRGSLGRTSGNYVIVVGHNPDEG
KTRLKLPSGAKKIVSSNARGVIGVVAGGGRIDKPLLKAGRAFHKYKVKRNSWPRTRGVAMNPVDHPHGGGNHQHIGKAST
ISRNAVPGQKVGLIAARRTGLLRGTQKTKE

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome