Protein

MIA_02526_1

Length
517 amino acids

Browser: contig03:1049618-1051235-

Protein function

EGGNOG:0PGTJDBP5ATP-dependent RNA helicase associated with the nuclear pore complex and essential for mRNA export from the nucleus. May participate in a terminal step of mRNA export through the removal of proteins that accompany mRNA through the nucleopore complex. May also be involved in early transcription (By similarity)
SGD closest match:S000005572DBP5ATP-dependent RNA helicase DBP5
CGD closest match:CAL0000188126DBP5ATP-dependent RNA helicase DBP5

Protein alignments

%idAln lengthE-value
MCA_02996_164.904%4163.45e-179MCA_02996_1
DBP5_YEAST62.679%4181.41e-177ATP-dependent RNA helicase DBP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP5 PE=1 SV=2
UniRef50_Q75C3961.483%4183.14e-173ATP-dependent RNA helicase DBP5 n=185 Tax=Fungi TaxID=4751 RepID=DBP5_ASHGO
A0A167DPL9_9ASCO63.571%4201.08e-174ATP-dependent RNA helicase DBP5 OS=Sugiyamaella lignohabitans GN=DBP5 PE=3 SV=1
DBP5_CANAL62.679%4183.46e-172ATP-dependent RNA helicase DBP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP5 PE=3 SV=2
A0A0J9XL42_GEOCN61.483%4181.57e-170Similar to Saccharomyces cerevisiae YOR046C DBP5 Cytoplasmic ATP-dependent RNA helicase of the DEAD-box family OS=Geotrichum candidum GN=BN980_GECA26s00076g PE=3 SV=1
A0A1E3PS36_9ASCO62.679%4184.62e-170DEAD-domain-containing protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48433 PE=3 SV=1
A0A060TFS5_BLAAD62.143%4203.72e-169ARAD1D25454p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D25454g PE=3 SV=1
DBP5_YARLI59.472%4172.46e-167ATP-dependent RNA helicase DBP5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP5 PE=3 SV=1
A0A1E4TLH5_9ASCO54.878%4102.51e-149Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_48686 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2108

Protein family membership

None predicted.

Domains and repeats

  1. Domain
  2. Domain
  3. Domain
1 50 100 150 200 250 300 350 400 450 517

Detailed signature matches

  1. Domain IPR014014
    RNA helicase, DEAD-box type, Q motif
    1. PS51195 (Q_MOTIF)
  2. Domain IPR014001
    Helicase superfamily 1/2, ATP-binding domain
    1. PS51192 (HELICASE_A...)
    2. SM00487 (ultradead3)
  3. Domain IPR011545
    DEAD/DEAH box helicase domain
    1. PF00270 (DEAD)
  4. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  5. Domain IPR001650
    Helicase, C-terminal
    1. PS51194 (HELICASE_CTER)
    2. SM00490 (helicmild6)
    3. PF00271 (Helicase_C)
  6. SITE IPR000629
    ATP-dependent RNA helicase DEAD-box, conserved site
    1. PS00039 (DEAD_ATP_H...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:3.40.50...
  3. cd00079 (HELICc)
  4. cd00268 (DEADc)
  5. mobidb-lite (disord...)

Residue annotation

  1. ATP binding site c...
  2. Mg++ binding site ...
  3. motif III cd00268
  4. nucleotide binding...
  5. ATP-binding site c...

Protein sequence

>MIA_02526_1
MSLASRLNPLSNEEADKIIAKEQAETPASQETENLADALSSVALTTEKKPEAEKKDAEADKKDTKEDIKEDTKEDTKEDT
KESKEESSEVSEKDLKDEISNLVKNDYEVSVKLADLQADPNSPLYSVKKFDELGLSEELLKGLTAMKFYQPSKIQEKALP
LLMKKPYVNFIGQSQSGTGKTAAFTLSMLNRVDVNNPKTQAICLSPARELARQTLDVVEEMAKFTDIKTKVLVPDSYVRD
VKIDAQVVVGTPGTMTDLIRRKMLDVSALKILVLDEADNMIGQGSLGDQSLRLKRLLPKNIQVVLFSATFDDDVYEYALR
FVPDPKNEIRLKPTELNVKEITQVYMDIDSESERIKVLTDIYGLMTIGSSIIFTAKKETANTLYKTMKMEGHAVSVLHSD
LDSVSRDKLIDDFRNGTSKVLITTNVLARGIDIPSVNVVVNFDLPTTREGRPDPETYLHRIGRTGRFGRKGIALSFVQDE
RSFKILQAIQDYFHLELIQVDHNDLDSVEKVFKKAMN

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0003676 nucleic acid binding
GO:0005524 ATP binding

Cellular Component

None predicted.