Protein

MIA_02403_1

Length
356 amino acids


Browser: contig03:709465-710536+

Protein function

EGGNOG:0PG24BTGEBeta-glucosidases are one of a number of cellulolytic enzymes involved in the degradation of cellulosic biomass. Catalyzes the last step releasing glucose from the inhibitory cellobiose (By similarity)
SGD closest match:S000002996SCW11Probable family 17 glucosidase SCW11
CGD closest match:CAL0000194867SCW11Putative glucan endo-1\3-beta-D-glucosidase

Protein alignments

%idAln lengthE-value
MCA_01789_152.297%2833.40e-98MCA_01789_1
A0A0J9X4Q1_GEOCN47.126%2614.00e-89Similar to Saccharomyces cerevisiae YGL028C SCW11 Cell wall protein with similarity to glucanases OS=Geotrichum candidum GN=BN980_GECA02s06720g PE=4 SV=1
UniRef50_A0A0J9X4Q147.126%2618.17e-86Similar to Saccharomyces cerevisiae YGL028C SCW11 Cell wall protein with similarity to glucanases n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X4Q1_GEOCN
A0A1E3PEI2_9ASCO48.837%2581.19e-86Glycoside hydrolase (Fragment) OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_4505 PE=4 SV=1
Q6C545_YARLI46.183%2621.96e-83YALI0E21109p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E21109g PE=4 SV=1
A0A167CBH0_9ASCO48.473%2624.20e-80Scw11p OS=Sugiyamaella lignohabitans GN=SCW11 PE=4 SV=1
A0A1E4TDI8_9ASCO46.388%2634.98e-83Glycoside hydrolase family 17 protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_17528 PE=4 SV=1
SCW11_YEAST46.388%2639.11e-78Probable family 17 glucosidase SCW11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCW11 PE=1 SV=1
A0A1D8PNW1_CANAL42.366%2624.24e-70Putative glucan endo-1\3-beta-D-glucosidase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SCW11 PE=4 SV=1
A0A060TAI0_BLAAD43.130%2621.34e-70ARAD1D24156p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D24156g PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.7878

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 356

Detailed signature matches

    1. SSF51445 ((Trans)gl...)
Unintegrated signatures no IPR
Unintegrated signatures

Protein sequence

>MIA_02403_1
MRFSFLLLLSSTLSSVVKSAPTNALEDHLSHSLSHFPKHANSTPEYPIHEHGSNLQEKKLHSRSAWSIPNAINRFVQVSD
PGPNNVVNFVPPFITYSTINNDFSCKGYDQVFGEFLQIKAKGIRGVRVYGVDCNSYWTVQPAARALGLKIMQGFWITQAG
TWSINQAVTDLANWIKYYNGNNWDLIDSIIVGNEAVTAGWIDAHQLLGKIRDVRGQLRQAGYLGPISTAEIPSVFMQNPF
LCVGDDTIDFVGVNAHPYFDSGKRFDQAGEFMQSQVDVVSQACQGKPVKIVETGYPSGGNIHGNQVPSPRGQAVAITQIY
NVLKGDVVMFTMYDDYWKSPGPFNIEQKFGMFWLLP

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.