Protein

MIA_02347_1

Length
192 amino acids


Browser: contig03:530887-531565+

Protein function

EGGNOG:0PQXBFG10218.1mitochondrial 37S ribosomal protein RSM18
SGD closest match:S000000852RSM1837S ribosomal protein RSM18, mitochondrial
CGD closest match:CAL0000192931orf19.5201Mitochondrial 37S ribosomal protein RSM18

Protein alignments

%idAln lengthE-value
A0A0J9X5D6_GEOCN44.444%1176.38e-21Similar to Saccharomyces cerevisiae YER050C RSM18 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA03s04432g PE=4 SV=1
UniRef50_A0A0J9X5D644.444%1171.31e-17Similar to Saccharomyces cerevisiae YER050C RSM18 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5D6_GEOCN
MCA_01621_150.000%1061.22e-17MCA_01621_1
A0A060TGE7_BLAAD43.689%1034.17e-15ARAD1D22990p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D22990g PE=4 SV=1
A0A1E3PNF8_9ASCO38.655%1192.66e-09Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81596 PE=3 SV=1
RSM18_YEAST40.196%1025.53e-0937S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM18 PE=1 SV=2
Q59KY7_CANAL33.333%1171.95e-08Mitochondrial 37S ribosomal protein RSM18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5201 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9342
Predicted cleavage: 30

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. SSF46911 (Ribosomal...)
    2. PF01084 (Ribosomal_S18)
    3. PR00974 (RIBOSOMALS18)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_02347_1
MFPVTKSFKTTLQRTGFSARFFSSTIVGLNQASQPKSPKETEKGKDKKTFKSRSTSRRSDSETLKTSIAYTQKIDGSNSA
SPVFEIDPLLYPRFESTQTYDPFDFSLTSVKMKLQASYNGPVNERSFGNIKDPLDLWKRPDILNEFVTSNGKIVQGVVVG
NKGKTHKRISKAIRRSRAAGLMPYFHKSSLFQ

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome