Protein
MIA_02347_1
Length
192 amino acids
Browser: contig03:530887-531565+
Protein function
EGGNOG: | 0PQXB | FG10218.1 | mitochondrial 37S ribosomal protein RSM18 |
---|---|---|---|
SGD closest match: | S000000852 | RSM18 | 37S ribosomal protein RSM18, mitochondrial |
CGD closest match: | CAL0000192931 | orf19.5201 | Mitochondrial 37S ribosomal protein RSM18 |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
A0A0J9X5D6_GEOCN | 44.444% | 117 | 6.38e-21 | Similar to Saccharomyces cerevisiae YER050C RSM18 Mitochondrial ribosomal protein of the small subunit OS=Geotrichum candidum GN=BN980_GECA03s04432g PE=4 SV=1 |
UniRef50_A0A0J9X5D6 | 44.444% | 117 | 1.31e-17 | Similar to Saccharomyces cerevisiae YER050C RSM18 Mitochondrial ribosomal protein of the small subunit n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X5D6_GEOCN |
MCA_01621_1 | 50.000% | 106 | 1.22e-17 | MCA_01621_1 |
A0A060TGE7_BLAAD | 43.689% | 103 | 4.17e-15 | ARAD1D22990p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D22990g PE=4 SV=1 |
A0A1E3PNF8_9ASCO | 38.655% | 119 | 2.66e-09 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81596 PE=3 SV=1 |
RSM18_YEAST | 40.196% | 102 | 5.53e-09 | 37S ribosomal protein RSM18, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSM18 PE=1 SV=2 |
Q59KY7_CANAL | 33.333% | 117 | 1.95e-08 | Mitochondrial 37S ribosomal protein RSM18 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5201 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9342
Predicted cleavage: 30
Protein family membership
- Ribosomal protein S18 (IPR001648)
Domains and repeats
None predicted.
Detailed signature matches

Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_02347_1 MFPVTKSFKTTLQRTGFSARFFSSTIVGLNQASQPKSPKETEKGKDKKTFKSRSTSRRSDSETLKTSIAYTQKIDGSNSA SPVFEIDPLLYPRFESTQTYDPFDFSLTSVKMKLQASYNGPVNERSFGNIKDPLDLWKRPDILNEFVTSNGKIVQGVVVG NKGKTHKRISKAIRRSRAAGLMPYFHKSSLFQ
GO term prediction
Biological Process
GO:0006412 translation
Molecular Function
GO:0003735 structural constituent of ribosome
Cellular Component
GO:0005622 intracellular
GO:0005840 ribosome