Protein

MIA_02235_1

Length
157 amino acids


Browser: contig03:235630-236104-

Protein function

EGGNOG:0PPVKEGD1Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting (By similarity). The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum (By similarity). EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II (By similarity)
SGD closest match:S000005958EGD1Nascent polypeptide-associated complex subunit beta-1
CGD closest match:CAL0000174763EGD1Nascent polypeptide-associated complex subunit beta

Protein alignments

%idAln lengthE-value
MCA_01937_164.331%1572.74e-67MCA_01937_1
A0A0J9XBN2_GEOCN65.409%1591.48e-65Nascent polypeptide-associated complex subunit beta OS=Geotrichum candidum GN=BN980_GECA08s02738g PE=3 SV=1
UniRef50_A0A0J9XBN265.409%1593.04e-62Nascent polypeptide-associated complex subunit beta n=3 Tax=Dikarya TaxID=451864 RepID=A0A0J9XBN2_GEOCN
A0A060TF31_BLAAD54.487%1561.26e-58Nascent polypeptide-associated complex subunit beta OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19690g PE=3 SV=1
A0A161HKE4_9ASCO57.051%1563.51e-58Nascent polypeptide-associated complex subunit beta OS=Sugiyamaella lignohabitans GN=EGD1 PE=3 SV=1
A0A1E3PS35_9ASCO50.314%1592.98e-45Nascent polypeptide-associated complex subunit beta OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68510 PE=3 SV=1
NACB1_YEAST45.860%1575.08e-37Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD1 PE=1 SV=2
A0A1E4TG37_9ASCO44.872%1565.36e-37Nascent polypeptide-associated complex subunit beta OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25099 PE=3 SV=1
NACB_YARLI46.250%1602.43e-36Nascent polypeptide-associated complex subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD1 PE=3 SV=1
NACB_CANAL46.951%1643.70e-36Nascent polypeptide-associated complex subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD1 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0430

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 157

Detailed signature matches

Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Protein sequence

>MIA_02235_1
MVLDAEKLAKLQQSVRIGGKGTPRRKVKKTTKSNEADEAKIQTALKKLNAQTIQGIDQVNFFNDDGTVLHFPRPNVQAAT
SSNTFAIHGRPQEKQLEELMPGIITQLGAENIEKLRELASQLGSGLKQGAEGLEASGEPEDEGIPELVSGENFDKVD

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.