Protein
MIA_02235_1
Length
157 amino acids
Browser: contig03:235630-236104-
Protein function
| EGGNOG: | 0PPVK | EGD1 | Component of the nascent polypeptide-associated complex (NAC), a dynamic component of the ribosomal exit tunnel, protecting the emerging polypeptides from interaction with other cytoplasmic proteins to ensure appropriate nascent protein targeting (By similarity). The NAC complex also promotes mitochondrial protein import by enhancing productive ribosome interactions with the outer mitochondrial membrane and blocks the inappropriate interaction of ribosomes translating non-secretory nascent polypeptides with translocation sites in the membrane of the endoplasmic reticulum (By similarity). EGD1 may act as a transcription factor that exert a negative effect on the expression of several genes that are transcribed by RNA polymerase II (By similarity) |
|---|---|---|---|
| SGD closest match: | S000005958 | EGD1 | Nascent polypeptide-associated complex subunit beta-1 |
| CGD closest match: | CAL0000174763 | EGD1 | Nascent polypeptide-associated complex subunit beta |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01937_1 | 64.331% | 157 | 2.74e-67 | MCA_01937_1 |
| A0A0J9XBN2_GEOCN | 65.409% | 159 | 1.48e-65 | Nascent polypeptide-associated complex subunit beta OS=Geotrichum candidum GN=BN980_GECA08s02738g PE=3 SV=1 |
| UniRef50_A0A0J9XBN2 | 65.409% | 159 | 3.04e-62 | Nascent polypeptide-associated complex subunit beta n=3 Tax=Dikarya TaxID=451864 RepID=A0A0J9XBN2_GEOCN |
| A0A060TF31_BLAAD | 54.487% | 156 | 1.26e-58 | Nascent polypeptide-associated complex subunit beta OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D19690g PE=3 SV=1 |
| A0A161HKE4_9ASCO | 57.051% | 156 | 3.51e-58 | Nascent polypeptide-associated complex subunit beta OS=Sugiyamaella lignohabitans GN=EGD1 PE=3 SV=1 |
| A0A1E3PS35_9ASCO | 50.314% | 159 | 2.98e-45 | Nascent polypeptide-associated complex subunit beta OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_68510 PE=3 SV=1 |
| NACB1_YEAST | 45.860% | 157 | 5.08e-37 | Nascent polypeptide-associated complex subunit beta-1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EGD1 PE=1 SV=2 |
| A0A1E4TG37_9ASCO | 44.872% | 156 | 5.36e-37 | Nascent polypeptide-associated complex subunit beta OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25099 PE=3 SV=1 |
| NACB_YARLI | 46.250% | 160 | 2.43e-36 | Nascent polypeptide-associated complex subunit beta OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=EGD1 PE=3 SV=1 |
| NACB_CANAL | 46.951% | 164 | 3.70e-36 | Nascent polypeptide-associated complex subunit beta OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=EGD1 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0430
Protein family membership
None predicted.
Domains and repeats
-
Domain
1
20
40
60
80
100
120
140
157
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_02235_1 MVLDAEKLAKLQQSVRIGGKGTPRRKVKKTTKSNEADEAKIQTALKKLNAQTIQGIDQVNFFNDDGTVLHFPRPNVQAAT SSNTFAIHGRPQEKQLEELMPGIITQLGAENIEKLRELASQLGSGLKQGAEGLEASGEPEDEGIPELVSGENFDKVD
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.