Protein

MIA_02134_1

Length
146 amino acids


Browser: contig02:2721763-2722204+

Protein function

EGGNOG:0PMZERPS1640s ribosomal protein s16
SGD closest match:S000004751RPS16A40S ribosomal protein S16-A

Protein alignments

%idAln lengthE-value
MCA_05705_195.804%1432.64e-85MCA_05705_1
RS16A_YEAST87.324%1421.40e-7640S ribosomal protein S16-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS16A PE=1 SV=1
UniRef50_P0CX5187.324%1423.36e-7340S ribosomal protein S16-A n=577 Tax=Eukaryota TaxID=2759 RepID=RS16A_YEAST
A0A060T6U1_BLAAD87.050%1391.42e-76ARAD1B17952p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B17952g PE=3 SV=1
A0A0J9XD31_GEOCN91.379%1162.28e-76Similar to Saccharomyces cerevisiae YDL083C RPS16B Protein component of the small (40S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA10s02067g PE=3 SV=1
A0A1E3PIA5_9ASCO87.324%1423.67e-7540S ribosomal protein S16 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_42905 PE=3 SV=1
Q6CEU5_YARLI84.058%1381.42e-73YALI0B12848p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B12848g PE=3 SV=2
A0A1D8PCW6_CANAL86.232%1381.17e-71Ribosomal 40S subunit protein S16A OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS16A PE=3 SV=1
A0A1E4TLZ3_9ASCO79.310%1455.21e-71Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1364 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1880

Protein family membership

Domains and repeats

1 20 40 60 80 100 120 146

Detailed signature matches

    1. PF00380 (Ribosomal_S9)
    1. SSF54211 (Ribosomal...)
    1. PS00360 (RIBOSOMAL_S9)

Protein sequence

>MIA_02134_1
MSDSTPVPSVQTFGKKKTATAVAHVKAGKGLLKVNGSPITLVQPEILRFKVYEPLLIVGLDKFANIDIRVKVSGGGHVSQ
VYAIRQAIAKGLIAYYQKYVDEQSKNELKKALISYDRTLLIADPRRCEPKKFGGPGARARYQKSYR

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005840 ribosome