Protein

MIA_02001_1

Length
131 amino acids

Browser: contig02:2320449-2320923-

Protein function

EGGNOG:0PPVDFG10822.1prefoldin subunit 4
SGD closest match:S000005097GIM3Prefoldin subunit 4
CGD closest match:CAL0000198712orf19.1273Prefoldin subunit 4

Protein alignments

%idAln lengthE-value
MCA_02507_159.848%1324.00e-41MCA_02507_1
A0A0J9X691_GEOCN57.252%1311.58e-33Prefoldin subunit 4 OS=Geotrichum candidum GN=BN980_GECA03s05686g PE=3 SV=1
A0A1E3PRY0_9ASCO53.077%1305.97e-32Prefoldin subunit 4 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_48698 PE=3 SV=1
A0A060T987_BLAAD48.462%1303.05e-29Prefoldin subunit 4 OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C42064g PE=3 SV=1
UniRef50_A0A163KJY846.154%1302.73e-24Prefoldin subunit 4 n=20 Tax=Fungi TaxID=4751 RepID=A0A163KJY8_ABSGL
PFD4_YEAST41.538%1301.21e-21Prefoldin subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIM3 PE=1 SV=1
Q6CI49_YARLI44.068%1181.83e-21Prefoldin subunit 4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A01738g PE=3 SV=1
Q5A435_CANAL40.769%1303.53e-20Prefoldin subunit 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.1273 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0036

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR002777
    Prefoldin beta-like
    1. PF01920 (Prefoldin_2)
  2. Family IPR016661
    Prefoldin, subunit 4
    1. PIRSF016477 (Prefol...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.28...
  3. SSF46579 (Prefoldin)

Protein sequence

>MIA_02001_1
MQMLPADHKPNPEIEVLWEDQERINTFSKLNSRISVLRNSLKSHEQEKEYLSDVEMELELLDEDDEIQYKIGEAFIYLSQ
EEALERLQRDTEKVDKLIQEEEEQIGKTAQQMTALKGLLYGKFGNAINLEA

GO term prediction

Biological Process

GO:0006457 protein folding

Molecular Function

GO:0051082 unfolded protein binding

Cellular Component

GO:0016272 prefoldin complex