Protein
MIA_01987_1
Length
442 amino acids
Browser: contig02:2279275-2280946+
Protein function
| EGGNOG: | 0PI1H | PEX3 | Peroxisomal membrane protein |
|---|---|---|---|
| SGD closest match: | S000002737 | PEX3 | Peroxisomal biogenesis factor 3 |
| CGD closest match: | CAL0000196480 | PEX3 | Pex3p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05273_1 | 50.36% | 554 | 1e-170 | MCA_05273_1 |
| A0A0J9XA04_GEOCN | 53.97% | 478 | 8e-168 | Similar to Saccharomyces cerevisiae YDR329C PEX3 Peroxisomal membrane protein (PMP) required for proper localization and stability of PMPs OS=Geotrichum candidum GN=BN980_GECA06s04707g PE=4 SV=1 |
| UniRef50_A0A0J9XA04 | 53.97% | 478 | 2e-164 | Similar to Saccharomyces cerevisiae YDR329C PEX3 Peroxisomal membrane protein (PMP) required for proper localization and stability of PMPs n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XA04_GEOCN |
| A0A060T8S8_BLAAD | 50.91% | 440 | 2e-149 | ARAD1C39138p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C39138g PE=4 SV=1 |
| A0A167CQR9_9ASCO | 46.46% | 495 | 5e-141 | Pex3p OS=Sugiyamaella lignohabitans GN=PEX3 PE=4 SV=1 |
| PEX3_YARLI | 45.23% | 451 | 2e-120 | Peroxisomal biogenesis factor 3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PEX3 PE=3 SV=1 |
| A0A1E3PDJ3_9ASCO | 38.54% | 467 | 2e-82 | Peroxin-3 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53119 PE=4 SV=1 |
| A0A1E4TFG7_9ASCO | 33.33% | 453 | 1e-67 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_106388 PE=4 SV=1 |
| A0A1D8PE25_CANAL | 29.29% | 495 | 3e-43 | Pex3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PEX3 PE=4 SV=1 |
| PEX3_YEAST | 25.05% | 467 | 3e-31 | Peroxisomal biogenesis factor 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PEX3 PE=1 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9456
Predicted cleavage: 26
Protein family membership
- Peroxin-3 (IPR006966)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
-
NON_CYTOPLASM... (N...)
-
TRANSMEMBRANE (Tran...)
Protein sequence
>MIA_01987_1 MSLVSSVGTFFRRHRRKLLVSAGIVASGYLAIDYLKNKFFELQDRLASERTAKENLRRRFDQNQEDATFTIMALLPGLSA DIIDAYPVENITQQLQQKRSAASRSVISAEGAVSETGSEAGTTVSTTIEGEASAVLVETRPRISKTQLWQELKIEAIARL FTLIYSTALLVFLTRVQLNILGRKNYVVSVIELADSRSPTGEVEEEEEDGDERAEQEAATNRLYLMFSWWLLNRGWLVLK EQVTTAVERVFGPINPRADLTLEKLSELIGQVQYLIDYPFDSAVAQNFLHNLIPPEELETYVLAQALQDPSAETEELAPG LRELLDETADLVESPNAGEVIKRLVHTGLSISVSKISQLYPPEEEKVRIEEREEGEEEESPKPVATVKLASILANISRQA HSVGAGTPLEPSEYVSAMANVSDLNAFSAVVYSNFDWRALDK
GO term prediction
Biological Process
GO:0007031 peroxisome organization
Molecular Function
None predicted.
Cellular Component
GO:0005779 integral component of peroxisomal membrane