Protein
MIA_01877_1
Length
269 amino acids
Browser: contig02:1953085-1953895-
Protein function
| EGGNOG: | 0PK4M | CYT2 | cytochrome C1 heme lyase |
|---|---|---|---|
| SGD closest match: | S000001570 | CYT2 | Cytochrome c1 heme lyase |
| CGD closest match: | CAL0000186461 | CYT2 | Cytochrome c heme lyase |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05779_1 | 68.401% | 269 | 5.81e-135 | MCA_05779_1 |
| A0A1E3PF49_9ASCO | 56.835% | 278 | 6.88e-115 | Cytochrome c heme lyase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_83938 PE=3 SV=1 |
| A0A0J9X9Q1_GEOCN | 58.545% | 275 | 6.90e-110 | Cytochrome c heme lyase OS=Geotrichum candidum GN=BN980_GECA06s03068g PE=3 SV=1 |
| A0A167DY66_9ASCO | 57.634% | 262 | 2.04e-109 | Cytochrome c heme lyase OS=Sugiyamaella lignohabitans GN=CYT2 PE=3 SV=1 |
| A0A060T1I2_BLAAD | 62.338% | 231 | 2.27e-101 | Cytochrome c heme lyase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A00748g PE=3 SV=1 |
| Q6C6U2_YARLI | 52.708% | 277 | 2.15e-93 | Cytochrome c heme lyase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E06215g PE=3 SV=1 |
| UniRef50_A0A1B7SHG3 | 48.789% | 289 | 5.67e-84 | Cytochrome c heme lyase n=1 Tax=Ogataea polymorpha TaxID=460523 RepID=A0A1B7SHG3_9ASCO |
| Q5AMR8_CANAL | 45.652% | 276 | 1.77e-80 | Cytochrome c heme lyase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CYT2 PE=3 SV=1 |
| A0A1E4TK22_9ASCO | 46.124% | 258 | 1.33e-79 | Cytochrome c heme lyase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_715 PE=3 SV=1 |
| CYT2_YEAST | 47.598% | 229 | 2.61e-72 | Cytochrome c1 heme lyase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYT2 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0253
Protein family membership
- Cytochrome c/c1 haem-lyase (IPR000511)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
mobidb-lite (disord...)
Protein sequence
>MIA_01877_1 MSTDTTKPQGVCPVDHTTREAWIRNAGSNQKPLLEDKLNQQQSAPAPHPVTAGSDEAKCPVNHESRAVWLQNGGEGRVNI ENCSSDRLGSNTSSPSTAIDSRGHILSTEREISTIPRASTGDNWVYPSQQQFFSAMQRKNWDPNADDMKTVVPIHNAVNE RAWMEILKWEHGEGGESCGGPQLVRFQGDSKKITPKARFNMIFGYQKPFDRHDWLVDRCGTQVEYVLDFYSGKPNPLMPE MPSFYIDVRPKLNSIEGCRMRLFKWLGLK
GO term prediction
Biological Process
None predicted.
Molecular Function
GO:0004408 holocytochrome-c synthase activity
Cellular Component
GO:0005739 mitochondrion