Protein

MIA_01853_1

Length
266 amino acids


Browser: contig02:1881112-1881913-

Protein function

EGGNOG:0PGPWRPS0Required for the assembly and or stability of the 40S ribosomal subunit. Required for the processing of the 20S rRNA- precursor to mature 18S rRNA in a late step of the maturation of 40S ribosomal subunits (By similarity)
SGD closest match:S000004038RPS0B40S ribosomal protein S0-B
CGD closest match:CAL0000191976RPS040S ribosomal protein S0

Protein alignments

%idAln lengthE-value
A0A0J9X8F1_GEOCN81.281%2036.85e-11440S ribosomal protein S0 OS=Geotrichum candidum GN=RPS0 PE=3 SV=1
A0A060T537_BLAAD78.431%2041.77e-11140S ribosomal protein S0 OS=Blastobotrys adeninivorans GN=RPS0 PE=3 SV=1
RSSA_CANAL77.387%1996.42e-10740S ribosomal protein S0 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPS0 PE=2 SV=2
UniRef50_O4281777.387%1991.56e-10340S ribosomal protein S0 n=106 Tax=Eukaryota TaxID=2759 RepID=RSSA_CANAL
A0A1E3PIC8_9ASCO77.228%2022.31e-10640S ribosomal protein S0 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=RPS0 PE=3 SV=1
RSSA2_YEAST73.869%1994.81e-10340S ribosomal protein S0-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPS0B PE=1 SV=2
RSSA_YARLI76.000%2003.87e-10040S ribosomal protein S0 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RPS0 PE=3 SV=2
A0A1E4TF40_9ASCO71.429%2031.11e-9940S ribosomal protein S0 OS=Tortispora caseinolytica NRRL Y-17796 GN=RPS0 PE=3 SV=1
A0A167CIV1_9ASCO82.286%1755.93e-9840S ribosomal protein S0 OS=Sugiyamaella lignohabitans GN=RPS0A PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0177

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 266

Detailed signature matches

    1. PR00395 (RIBOSOMALS2)
    2. PF00318 (Ribosomal_S2)
    3. cd01425 (RPS2)
    1. MF_03015 (Ribosomal...)
    1. SSF52313 (Ribosomal...)
    1. PS00962 (RIBOSOMAL_...)
    2. PS00963 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. rRNA interaction s...
  2. S8 interaction sit...
  3. putative laminin-1...

Protein sequence

>MIA_01853_1
MSDIFNLTPEDAQLLLAAGVHLGSKNKVVNMESYIHATRPDGVNIINISKTWEKIVLAARVIAAVPNAADVVAISARIYG
QRAVLKFASHTGATAIAGRFTPGSFTNYNTRSFKEPRLIVVTDTRLDAQAIKESSYVNIPVIALCDVDSPVEYVDVAIPC
NNRSKNAVGLVWWLISREVLRLKGILPDRQTQWNVMPDLYFYRDPEEPETTTVTEEEPAEEFVAEVAATTEEWDAAAAVD
ASGDWAAADDWASESAPVAPTPATAA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome
GO:0015935 small ribosomal subunit