Protein

MIA_01822_1

Length
555 amino acids

Browser: contig02:1779104-1780772+

Protein function

EGGNOG:0PFKGAIM14cell surface metalloreductase. May be involved in iron or copper homeostasis (By similarity)
SGD closest match:S000004037FRE8Probable ferric reductase transmembrane component 8
CGD closest match:CAL0000178992orf19.867Putative metalloreductase

Protein alignments

%idAln lengthE-value
MCA_04016_141.94%4655e-60MCA_04016_1
A0A0J9XIR6_GEOCN34.36%5501e-54Similar to Saccharomyces cerevisiae YLR047C FRE8 Protein with sequence similarity to iron/copper reductases OS=Geotrichum candidum GN=BN980_GECA20s01022g PE=4 SV=1
UniRef50_A0A0J9XIR634.36%5502e-51Similar to Saccharomyces cerevisiae YLR047C FRE8 Protein with sequence similarity to iron/copper reductases n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XIR6_GEOCN
A0A161HFK1_9ASCO35.44%4741e-51Aim14p OS=Sugiyamaella lignohabitans GN=AIM14 PE=4 SV=1
A0A1E3PUF0_9ASCO30.22%5561e-43Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81492 PE=4 SV=1
A0A060SZP4_BLAAD35.32%4361e-41ARAD1C06138p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06138g PE=4 SV=1
AIM14_YARLI32.53%4151e-31Probable metalloreductase AIM14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AIM14 PE=3 SV=1
A0A1D8PGY5_CANAL24.69%5594e-26Putative metalloreductase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.867 PE=4 SV=1
FRE8_YEAST28.19%3763e-23Probable ferric reductase transmembrane component 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRE8 PE=1 SV=1
A0A1E4THS6_9ASCO33.81%2789e-18Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_122182 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0036

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 100 200 300 400 500 555

Detailed signature matches

  1. Domain IPR013130
    Ferric reductase transmembrane component-like domain
    1. PF01794 (Ferric_reduct)
  2. Domain IPR017938
    Riboflavin synthase-like beta-barrel
    1. SSF63380 (Riboflavi...)
  3. Domain IPR013112
    FAD-binding 8
    1. PF08022 (FAD_binding_8)
  4. Domain IPR013121
    Ferric reductase, NAD binding domain
    1. PF08030 (NAD_binding_6)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:2.40.30.10
  3. G3DSA:3.40.50.80
  4. NON_CYTOPLASM... (N...)
  5. SFLDF00463 (AIM14)
  6. SFLDG01168 (Ferric_...)
  7. SFLDS00052 (Ferric_...)
  8. SSF52343 (Ferredoxi...)
  9. TMhelix
  10. TRANSMEMBRANE (Tran...)
  11. cd06186 (NOX_Duox_l...)
  12. mobidb-lite (disord...)

Residue annotation

  1. FAD binding pocket...
  2. FAD binding motif ...
  3. beta-alpha-beta st...
  4. NAD pyrophosphate ...
  5. NAD binding pocket...
  6. NADP ribose bindin...

Protein sequence

>MIA_01822_1
MPSSLIARHEGHDHSGPHYANIKYGYIALVTASSLLILAGIRTLIGRLVSARAAARGLSRRQRSVKWVSAVFNWRMPLPV
IVLFWVFFTILFCTVGLPEFTAKKLAKRAGRITYAMVPVVLALALKIPGSAVVIPSYLDMLTLHKWIARVVLAAAAVHVI
TYLAVYISTGRTDKIKKKDNMLGLIAAVLMAVVAVTSLKPVRRRAYRLFYFIHYPAAWLTVVLIIFHARPGVMVLAVLCL
FILFVGAVVRVWVAKTTRVVSVTRLSPTLSVLVLPRRVLPVYFEPGSHVRMGRGQMSLSLHPYTVASLPSDSEVRLLVRD
MSHPILPQDAAELSTSTPTTKLLVTGPYLPSGRASRMVREARCALIFAGGSGLSFAAGVARALEMRGAEVQVVWMVRRRE
EITALGLLEVAHAEVYVTGEGQVGKQEENPFDDEFELDELLRDDEEEQDGNTVVPPTPTQVRSRGGDEGDEEGTLVAGGG
AAAEGESKGVRIHEGRPDLRLVANEFFQAEERGGGQLGSAWVCACGPAGLVSQAQRWAGTYYEGEVEFVGEEYVL

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0016491 oxidoreductase activity

Cellular Component

None predicted.