Protein
MIA_01821_1
Length
91 amino acids
Browser: contig02:1778129-1778552+
Protein function
| EGGNOG: | 0PSKJ | Inherit from euNOG: NADH dehydrogenase ubiquinone iron-sulfur protein | |
|---|---|---|---|
| CGD closest match: | CAL0000182091 | orf19.332.1 | Uncharacterized protein |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_04017_1 | 81.319% | 91 | 1.99e-52 | MCA_04017_1 |
| A0A0J9XJX7_GEOCN | 78.022% | 91 | 1.18e-52 | NIPM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA20s01044g PE=4 SV=1 |
| UniRef50_A0A0J9XJX7 | 78.022% | 91 | 2.41e-49 | NIPM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9XJX7_GEOCN |
| A0A060T5K3_BLAAD | 45.455% | 88 | 3.79e-29 | ARAD1C06116p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C06116g PE=4 SV=1 |
| B5RSL7_YARLI | 42.697% | 89 | 4.87e-18 | YALI0F18359p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F18359g PE=4 SV=1 |
| A0A1E4TH38_9ASCO | 42.857% | 77 | 8.09e-18 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2790 PE=4 SV=1 |
| A0A1D8PJR3_CANAL | 41.270% | 63 | 1.00e-11 | Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.332.1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0759
Predicted cleavage: 23
Protein family membership
None predicted.
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
PS51808 (CHCH)
Protein sequence
>MIA_01821_1 MVSAIGLTGGSSRCFPEWQSFLECYTASSTSDVAKCQAKSADYYECLHHKKEKGRAILIANEMLKRKDEEGKLLDVVKKQ FSIDSLGLVKE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.