Protein

MIA_01787_1

Length
69 amino acids

Browser: contig02:1683874-1684198-

Protein function

EGGNOG:0PRYASSS1Protein transport protein SEC61
SGD closest match:S000002493SSS1Protein transport protein SSS1
CGD closest match:CAL0000182484orf19.6828.1Translocon subunit

Protein alignments

%idAln lengthE-value
MCA_02838_189.552%675.57e-41MCA_02838_1
A0A0J9X8F3_GEOCN79.710%693.24e-39Similar to Saccharomyces cerevisiae YDR086C SSS1 Subunit of the Sec61p translocation complex that forms a channel for passage of secretory proteins through the endoplasmic reticulum membrane OS=Geotrichum candidum GN=BN980_GECA05s02881g PE=3 SV=1
A0A1E3PU08_9ASCO76.812%691.31e-36Protein translocase SEC6 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44925 PE=3 SV=1
A0A060T5J7_BLAAD67.164%674.22e-30ARAD1B04928p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B04928g PE=3 SV=1
UniRef50_A0A060T5J767.164%671.04e-26ARAD1B04928p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060T5J7_BLAAD
A0A1D8PKK1_CANAL60.294%681.95e-30Translocon subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.6828.1 PE=3 SV=1
B5FVE3_YARLI66.667%638.44e-29YALI0D08635p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_D08635g PE=3 SV=1
SC61G_YEAST55.224%672.67e-25Protein transport protein SSS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SSS1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1543

Protein family membership

Domains and repeats

  1. Domain
1 10 20 30 40 50 60 69

Detailed signature matches

  1. Family IPR001901
    Protein translocase complex, SecE/Sec61-gamma subunit
    1. PS01067 (SECE_SEC61G)
    2. PF00584 (SecE)
  2. Family IPR008158
    Protein translocase SEC61 complex, gamma subunit
    1. TIGR00327
  3. Family IPR022943
    Preprotein translocase subunit SecE
    1. MF_00422 (SecE)
  4. Domain IPR023391
    Protein translocase SecE domain
    1. SSF103456 (Preprote...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:1.20.5.820
  3. NON_CYTOPLASM... (N...)
  4. TMhelix
  5. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_01787_1
MANDGFEKISEIPLDFIKEGNTFINRCTKPDAAEFLKIVRAVGIGFIVMGAIGYLVKLIHIPIRHLITV

GO term prediction

Biological Process

GO:0006605 protein targeting
GO:0006886 intracellular protein transport
GO:0015031 protein transport

Molecular Function

GO:0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity

Cellular Component

GO:0016020 membrane