Protein

MIA_01753_1

Length
107 amino acids

Browser: contig02:1587094-1587467-

Protein function

EGGNOG:0PQJSMicrosomal signal peptidase 12kDa subunit
SGD closest match:S000003770SPC1Signal peptidase complex subunit SPC1

Protein alignments

%idAln lengthE-value
A0A0J9XK00_GEOCN51.020%981.87e-21Similar to Saccharomyces cerevisiae YJR010C-A SPC1 Subunit of the signal peptidase complex (SPC) OS=Geotrichum candidum GN=BN980_GECA27s00389g PE=4 SV=1
UniRef50_A0A0J9XK0051.020%983.83e-18Similar to Saccharomyces cerevisiae YJR010C-A SPC1 Subunit of the signal peptidase complex (SPC) n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XK00_GEOCN
MCA_02489_149.020%1021.04e-20MCA_02489_1
A0A167F3P4_9ASCO37.662%779.21e-12Spc1p OS=Sugiyamaella lignohabitans GN=SPC1 PE=4 SV=1
B5RSM2_YARLI33.750%806.22e-12YALI0F26156p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F26156g PE=4 SV=1
SPC1_YEAST36.232%692.10e-09Signal peptidase complex subunit SPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC1 PE=1 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1975

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

  1. Family IPR009542
    Microsomal signal peptidase 12kDa subunit
    1. PF06645 (SPC12)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. NON_CYTOPLASM... (N...)
  3. TMhelix
  4. TRANSMEMBRANE (Tran...)

Protein sequence

>MIA_01753_1
MEAIKEFVDGVIDFEGQKLADSINFYTIWIGALFSIVLGFLTQSVLVSLYVSLFSLIVDLFVIVPAWPFYNKKQIQWLTP
PGFLADSEVTLSSKDTMNNDNILKVDI

GO term prediction

Biological Process

GO:0006465 signal peptide processing

Molecular Function

GO:0008233 peptidase activity

Cellular Component

GO:0005787 signal peptidase complex
GO:0016021 integral component of membrane