Protein

MIA_01733_1

Length
375 amino acids

Browser: contig02:1532980-1534261-

Protein function

EGGNOG:0PHFJFG00746.1deubiquitination-protection protein dph1
SGD closest match:S000004889DSK2Ubiquitin domain-containing protein DSK2
CGD closest match:CAL0000190403orf19.5345Uncharacterized protein

Protein alignments

%idAln lengthE-value
A0A0J9X583_GEOCN53.067%3751.94e-114Similar to Saccharomyces cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like polyubiquitin-binding protein OS=Geotrichum candidum GN=BN980_GECA02s08590g PE=4 SV=1
UniRef50_A0A0J9X58353.067%3753.96e-111Similar to Saccharomyces cerevisiae YMR276W DSK2 Nuclear-enriched ubiquitin-like polyubiquitin-binding protein n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A0J9X583_GEOCN
A0A060TA25_BLAAD47.739%3982.72e-108ARAD1D16038p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D16038g PE=4 SV=1
A0A167CKL2_9ASCO45.232%4092.88e-97Dsk2p OS=Sugiyamaella lignohabitans GN=DSK2 PE=4 SV=1
A0A1E3PMH2_9ASCO49.086%3836.83e-90Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50313 PE=4 SV=1
Q5A5Q4_CANAL44.032%3775.33e-86Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.5345 PE=4 SV=1
DSK2_YEAST39.948%3835.13e-73Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2
Q6C7B6_YARLI46.637%2232.88e-52YALI0E02134p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E02134g PE=4 SV=1
A0A1E4TKJ1_9ASCO39.130%2302.90e-38Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_12539 PE=4 SV=1
MCA_01369_187.234%472.39e-22MCA_01369_1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0067

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 375

Detailed signature matches

  1. Domain IPR029071
    Ubiquitin-related domain
    1. SSF54236 (Ubiquitin...)
  2. Domain IPR000626
    Ubiquitin domain
    1. SM00213 (ubq_7)
    2. PF00240 (ubiquitin)
    3. PS50053 (UBIQUITIN_2)
  3. Domain IPR006636
    Heat shock chaperonin-binding
    1. SM00727 (CBM)
  4. Domain IPR009060
    UBA-like
    1. SSF46934 (UBA-like)
  5. Domain IPR015940
    Ubiquitin-associated domain
    1. SM00165 (uba_6)
    2. PF00627 (UBA)
    3. PS50030 (UBA)
  6. SITE IPR019954
    Ubiquitin conserved site
    1. PS00299 (UBIQUITIN_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. Coil
  2. G3DSA:1.10.8.10
  3. G3DSA:3.10.20.90
  4. cd14324 (UBA_Dsk2p_...)
  5. mobidb-lite (disord...)

Residue annotation

  1. polypeptide substr...

Protein sequence

>MIA_01733_1
MSDTESSADTIEIIVKSSSDKKYNVKIALDATVLDLKTIVAEQSSIPVERQRIIYSGRVLKDHETIGTYKIKSGQTVHLI
RGAAPQSTPSTSSSVSGSAPSTASTTTPGVPTSFSTGGTVGNPLADLTGARYAGFANLPSASMFGPDGGMGSIPNPDELA
NLLSQPGVREQMNAMLSNPSMIEMLMNSNPQLQSMGPMFRSMMSNENFRNMLTNPDVIRSMMQMQQAMNPPSANTFPAPG
VAENTPETETRTPTNNPSNTGSTTSPSVDPTASLLSQMLGGAEQPDNPFSALLNPEAIQQQTQYLQSLNQAMEASRNAAN
AADQADSRPPEEKYESQLRQLNELGFYDFDRNVRALRRSGGHVQGAIEALLDNLI

GO term prediction

Biological Process

None predicted.

Molecular Function

GO:0005515 protein binding

Cellular Component

None predicted.