Protein
MIA_01696_1
Length
695 amino acids
Browser: contig02:1431363-1433451+
Protein function
| EGGNOG: | 0PIEZ | PGUG_03663 | vacuolar sorting protein |
|---|---|---|---|
| SGD closest match: | S000004388 | VPS33 | Vacuolar protein sorting-associated protein 33 |
| CGD closest match: | CAL0000186305 | VPS33 | Tethering complex ATP-binding subunit |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_01738_1 | 61.842% | 760 | 0.0 | MCA_01738_1 |
| A0A0J9XI93_GEOCN | 59.632% | 706 | 0.0 | Similar to Saccharomyces cerevisiae YLR396C VPS33 ATP-binding protein that is a subunit of the HOPS complex and of the CORVET tethering complex OS=Geotrichum candidum GN=BN980_GECA18s01902g PE=3 SV=1 |
| UniRef50_A0A0J9XI93 | 59.632% | 706 | 0.0 | Similar to Saccharomyces cerevisiae YLR396C VPS33 ATP-binding protein that is a subunit of the HOPS complex and of the CORVET tethering complex n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XI93_GEOCN |
| A0A060T2D9_BLAAD | 47.316% | 708 | 0.0 | ARAD1A07590p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A07590g PE=3 SV=1 |
| A0A167DM43_9ASCO | 43.404% | 758 | 0.0 | Tethering complex ATP-binding subunit VPS33 OS=Sugiyamaella lignohabitans GN=VPS33 PE=3 SV=1 |
| Q6C2Y2_YARLI | 35.237% | 718 | 1.63e-120 | YALI0F04125p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F04125g PE=3 SV=1 |
| A0A1E3PR26_9ASCO | 40.461% | 477 | 3.25e-104 | Sec1-like protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81017 PE=3 SV=1 |
| A0A1E4TM29_9ASCO | 31.404% | 691 | 2.31e-92 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_93368 PE=3 SV=1 |
| VPS33_YEAST | 25.159% | 473 | 7.48e-33 | Vacuolar protein sorting-associated protein 33 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPS33 PE=1 SV=1 |
| Q59MF4_CANAL | 20.803% | 274 | 2.62e-09 | Tethering complex ATP-binding subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPS33 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.2144
Protein family membership
- Sec1-like protein (IPR001619)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
Protein sequence
>MIA_01696_1 MAPVDTKALKDEALDSLLATLDAIRGRKCLVIDRSLASTLSLIASYGTLQEHGVEKMFWLDSPSLVDLISAAVTSSTSGP KYITFLVPSVASPHSATLVASTTQQLLSQSNNTDGSSTSPYYDISVIQTPDRAPDLVTVLENAGVLGDVSLHTWPIYFVP LAPDLLSLNMPGGGGFRDAYLANVPSTVHHAAAAIQDIQQRYGLVGRITGKGRAAQELVDILLRKREEHQTNLSEAVSRQ AGPSPSVNDIFDHQYTNIFSGKNIEQLVVIDRQIDPLTPLLTQLTYEGLIEEFYGITESGQVELPIHIVIPPQNKDTTQA HQNTSPLVLTSDSAEQHPDLVQNLTVDSKKVTLGNDHDQLFATIKDANFSTVGHTLNKVARQLQSDYEQRHEAKTVNQIK AFVGKLGGLQSLHQVLRFHTALAEELMSTLREEEFNKWLEIQQNLVADTLDLTQIHTMIGDLIDRESTPAMVLRLLCIDS VCNGGIKEKELLHFKREYLQTYGYHHLTTFENLETLGLLFPRHPSKPNWFPATRRQLALISEQQDDMDPSDIAFTYSGYS PLSVRIVQAAIDKEALFFGTKAKRGATATAPWKAVGWKGAEAILKNIPGPRVDEVQHDELFLREGKLRKILTRNSPIPPG SGPHKANIIVFYIGGITYAEIAALRFISERSSAFNILIATTGIISGDKIIDAASP
GO term prediction
Biological Process
GO:0006904 vesicle docking involved in exocytosis
GO:0016192 vesicle-mediated transport
Molecular Function
None predicted.
Cellular Component
None predicted.