Protein

MIA_01678_1

Length
383 amino acids

Browser: contig02:1379247-1380399+

Protein function

EGGNOG:0PH8TCCP1cytochrome c peroxidase
SGD closest match:S000001774CCP1Cytochrome c peroxidase, mitochondrial
CGD closest match:CAL0000199533CCP1Cytochrome c peroxidase, mitochondrial

Protein alignments

%idAln lengthE-value
MCA_01069_178.445%2838.75e-171MCA_01069_1
A0A0J9XDY7_GEOCN69.611%2831.07e-145Peroxidase OS=Geotrichum candidum GN=BN980_GECA11s03178g PE=3 SV=1
A0A167DS79_9ASCO69.338%2871.12e-139Peroxidase OS=Sugiyamaella lignohabitans GN=CCP1 PE=3 SV=1
A0A1E3PE10_9ASCO63.946%2949.98e-138Peroxidase OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_84267 PE=3 SV=1
A0A060SX42_BLAAD64.576%2711.16e-126Peroxidase OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A10450g PE=3 SV=1
UniRef50_A0A093VIX562.963%2701.02e-114Peroxidase n=3 Tax=Fungi TaxID=4751 RepID=A0A093VIX5_TALMA
CCPR_YARLI60.364%2752.93e-115Cytochrome c peroxidase, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CCP1 PE=3 SV=1
A0A1E4TBN6_9ASCO55.513%2631.81e-97Peroxidase OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_32495 PE=3 SV=1
CCPR_CANAL49.481%2894.48e-93Cytochrome c peroxidase, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CCP1 PE=3 SV=2
CCPR_YEAST47.917%2882.30e-91Cytochrome c peroxidase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCP1 PE=1 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.9877
Predicted cleavage: 42

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 250 300 350 383

Detailed signature matches

  1. Family IPR010255
    Haem peroxidase
    1. SSF48113 (Heme-depe...)
  2. Family IPR002207
    Plant ascorbate peroxidase
    1. PR00459 (ASPEROXIDASE)
  3. Domain IPR002016
    Haem peroxidase, plant/fungal/bacterial
    1. PS50873 (PEROXIDASE_4)
    2. PF00141 (peroxidase)
    3. PR00458 (PEROXIDASE)
  4. SITE IPR019794
    Peroxidase, active site
    1. PS00436 (PEROXIDASE_2)
  5. SITE IPR019793
    Peroxidases heam-ligand binding site
    1. PS00435 (PEROXIDASE_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. CYTOPLASMIC_D... (C...)
  2. G3DSA:1.10.42...
  3. G3DSA:1.10.52...
  4. NON_CYTOPLASM... (N...)
  5. TRANSMEMBRANE (Tran...)
  6. mobidb-lite (disord...)

Protein sequence

>MIA_01678_1
MASSRLATRAARPVLSTNLFSTFAAPKSFGAAAIAIATRRYNSSKTSSSSSSASPKTPPPEPKSSSSIGLIVAAAAVAGG
AYWAYSSYSAPSSQDKLAALAEHATKDDYQQVYNAIAKRIQDVDDEPDEGSYAPALVRLAWHSSGTWDRTSHTGGSGYGT
MRFDKEAHTGANAGLDRAKLFLEPISKQFPWLSHGDLYTLSGVTAIQELGGPTIKWRGGRIDGAEDKVPPDGRLPDASKG
ADHIRALFENRMGFTEGETVALIGAHALGRCHTSYSGYDGPWTFSPTYFTNDFFKLLEDEKWHVRKWDGPKQYQDDKTKS
LMMLPADYSLVQDKEFKKWVHRYATDNDFFFQEFARAFSTLLELGVNFKPNTPYYEFTRLDDQ

GO term prediction

Biological Process

GO:0006979 response to oxidative stress
GO:0055114 oxidation-reduction process

Molecular Function

GO:0004601 peroxidase activity
GO:0020037 heme binding

Cellular Component

None predicted.