Protein

MIA_01582_1

Length
136 amino acids


Browser: contig02:1127478-1127889-

Protein function

EGGNOG:0PSM6PAM18mitochondrial import inner membrane translocase subunit tim14
SGD closest match:S000003998PAM18Mitochondrial import inner membrane translocase subunit TIM14
CGD closest match:CAL0000200634PAM18Mitochondrial import inner membrane translocase subunit TIM14

Protein alignments

%idAln lengthE-value
MCA_04287_177.966%1181.30e-67MCA_04287_1
A0A0J9X309_GEOCN72.727%1213.37e-63Similar to Saccharomyces cerevisiae YNL328C MDJ2 Constituent of the mitochondrial import motor associated with the presequence translocase OS=Geotrichum candidum GN=BN980_GECA01s00285g PE=4 SV=1
UniRef50_A0A0J9X30972.727%1216.90e-60Similar to Saccharomyces cerevisiae YNL328C MDJ2 Constituent of the mitochondrial import motor associated with the presequence translocase n=8 Tax=Dikarya TaxID=451864 RepID=A0A0J9X309_GEOCN
A0A060TJU5_BLAAD70.339%1181.14e-54ARAD1D49654p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D49654g PE=4 SV=1
A0A1E3PFP2_9ASCO58.261%1153.53e-48J-protein co-chaperone of the mitochondrial import motor OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_53352 PE=4 SV=1
TIM14_CANAL53.913%1151.68e-37Mitochondrial import inner membrane translocase subunit TIM14 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAM18 PE=3 SV=1
TIM14_YARLI56.250%1123.42e-37Mitochondrial import inner membrane translocase subunit TIM14 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAM18 PE=3 SV=1
TIM14_YEAST60.396%1019.23e-35Mitochondrial import inner membrane translocase subunit TIM14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAM18 PE=1 SV=1
A0A1E4TC34_9ASCO58.333%966.82e-33Uncharacterized protein (Fragment) OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_18681 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0104

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 136

Detailed signature matches

    1. SM00271 (dnaj_3)
    2. PS50076 (DNAJ_2)
    3. SSF46565 (Chaperone...)
    4. cd06257 (DnaJ)
Unintegrated signatures no IPR
Unintegrated signatures
  1. TRANSMEMBRANE (Tran...)

Residue annotation

  1. HSP70 interaction ...

Protein sequence

>MIA_01582_1
MNSSLSDQQQPQQQKEAPGFFQEAYEDITSSFSNSPVMMGATAIAAVWVVKSLFFSKRGPGVGGREFFTGGFESKMNAKE
ALQILGLRESTLTKSKLKDSHRRIMLLNHPDKGGSPFLATKINEAKDFLEKRGGLK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.