Protein

MIA_01566_1

Length
148 amino acids

Browser: contig02:1091315-1091822-

Protein function

EGGNOG:0PNT9DCN1defective in cullin neddylation protein 1
SGD closest match:S000004118DCN1Defective in cullin neddylation protein 1
CGD closest match:CAL0000200583DCN1Defective in cullin neddylation protein 1

Protein alignments

%idAln lengthE-value
MCA_01676_157.718%1491.38e-59MCA_01676_1
A0A0J9X326_GEOCN47.101%1381.03e-44Defective in cullin neddylation protein OS=Geotrichum candidum GN=BN980_GECA01s00560g PE=4 SV=1
UniRef50_A0A0J9X32647.101%1382.12e-41Defective in cullin neddylation protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9X326_GEOCN
A0A060T305_BLAAD48.276%1452.84e-43Defective in cullin neddylation protein OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1C37004g PE=4 SV=1
DCN1_YARLI39.726%1461.04e-39Defective in cullin neddylation protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DCN1 PE=3 SV=1
A0A1E3PFR0_9ASCO42.105%1521.96e-33Defective in cullin neddylation protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_47506 PE=4 SV=1
A0A1E4TME9_9ASCO38.849%1399.71e-30Defective in cullin neddylation protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_1518 PE=4 SV=1
A0A167FPI3_9ASCO60.256%782.11e-29Defective in cullin neddylation protein OS=Sugiyamaella lignohabitans GN=AWJ20_3170 PE=4 SV=1
DCN1_YEAST29.054%1485.19e-20Defective in cullin neddylation protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCN1 PE=1 SV=1
DCN1_CANAL32.192%1461.78e-12Defective in cullin neddylation protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCN1 PE=3 SV=2

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0653

Protein family membership

None predicted.

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 148

Detailed signature matches

  1. Domain IPR005176
    Potentiating neddylation domain
    1. PF03556 (Cullin_bin...)
    2. PS51229 (DCUN1)

Protein sequence

>MIA_01566_1
MTLNAEAEGEFSKFGFIFGWLSLNVTTIPQMKAAVQHMKDQMQTNPAYFKNVYRFTYTYILPPNTRSLPTESAIAYWELL
LTDRFQKLAEWNEFILNVYKKSISKDTWNMILEFANYLPNDPDLANYDLEASWPSVIDEFVEYLKEKK

GO term prediction

Biological Process

None predicted.

Molecular Function

None predicted.

Cellular Component

None predicted.