Protein
MIA_01557_1
Length
314 amino acids
Browser: contig02:1069175-1070120+
Protein function
EGGNOG: | 0PFSH | PGUG_03997 | sphingolipid long chain base-responsive protein |
---|---|---|---|
SGD closest match: | S000003318 | PIL1 | Sphingolipid long chain base-responsive protein PIL1 |
CGD closest match: | CAL0000186520 | LSP1 | Lipid-binding protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_03268_1 | 77.778% | 270 | 7.82e-155 | MCA_03268_1 |
A0A060SWT9_BLAAD | 72.302% | 278 | 1.28e-142 | ARAD1A08008p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A08008g PE=4 SV=1 |
A0A167FXX6_9ASCO | 71.583% | 278 | 1.82e-141 | Lipid-binding protein PIL1 OS=Sugiyamaella lignohabitans GN=PIL1 PE=4 SV=1 |
A0A1E3PR35_9ASCO | 70.504% | 278 | 2.71e-140 | Putative sphingolipid long chain base-responsive protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_40564 PE=4 SV=1 |
PIL1_YEAST | 72.563% | 277 | 1.45e-137 | Sphingolipid long chain base-responsive protein PIL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PIL1 PE=1 SV=1 |
UniRef50_P53252 | 72.563% | 277 | 3.46e-134 | Sphingolipid long chain base-responsive protein PIL1 n=120 Tax=saccharomyceta TaxID=716545 RepID=PIL1_YEAST |
A0A0J9X4F0_GEOCN | 71.841% | 277 | 5.06e-138 | Similar to Saccharomyces cerevisiae YGR086C PIL1 Primary component of eisosomess, which are large immobile cell cortex structures associated with endocytosis OS=Geotrichum candidum GN=BN980_GECA02s04564g PE=4 SV=1 |
A0A1E4TF81_9ASCO | 65.359% | 306 | 3.60e-137 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_31398 PE=4 SV=1 |
Q6CC94_YARLI | 68.953% | 277 | 1.89e-136 | YALI0C11341p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C11341g PE=4 SV=1 |
Q59KV8_CANAL | 68.459% | 279 | 7.86e-132 | Lipid-binding protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=LSP1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.9558
Predicted cleavage: 47
Protein family membership
- Eisosome component PIL1/LSP1 (IPR028245)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_01557_1 MHRTYSLRQSRAPTASQQVNPPPPPSSTKSGRFFGKGSLGNTFRRNAAGSFAPEGSRKISQLVKTEKNVMRALELLAEER RNAAKGLTLWGEEQEDDVSDITDKISVLIYEMGMIDDAYIDHYDQYRLAMKSIRNIEASVIPSRNRKQQITDQIAVLKYK DPQSPRIVVLEQELVRAEAESLVAEAQLSNITREKLKQAFNYQFDAIKEHSERIALCASFGKVLLHLLDDSSVTPGETRE SYNGYEMSKQIIIDTEAALREWNSNSNDKPSLSIRQADPRELDDDSDLELEDQVKDEEEIQDSLENGNKKQYIP
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.