Protein

MIA_01527_1

Length
150 amino acids


Browser: contig02:989560-990046+

Protein function

EGGNOG:0PPKYCOF1Controls reversibly actin polymerization and depolymerization in a pH-sensitive manner. It has the ability to bind G- and F-actin in a 1 1 ratio of cofilin to actin. Binding to F-actin is regulated by tropomyosin. It is the major component of intranuclear and cytoplasmic actin rods. Required for accumulation of actin at the cell division site via depolymerizing actin at the cell ends. In association with myosin II has a role in the assembly of the contractile ring via severing actin filaments. Involved in the maintenance of the contractile ring once formed. In association with profilin and capping protein, has a role in the mitotic reorganization of the actin cytoskeleton (By similarity)
SGD closest match:S000003973COF1Cofilin
CGD closest match:CAL0000176762COF1Cofilin

Protein alignments

%idAln lengthE-value
COFI_YARLI61.806%1446.06e-64Cofilin OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=COF1 PE=3 SV=1
A0A1E3PQZ4_9ASCO59.459%1482.95e-63Cofilin OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_63370 PE=3 SV=1
A0A1E4TAN4_9ASCO61.111%1443.51e-63Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_128855 PE=3 SV=1
UniRef50_G8Y1W961.538%1433.57e-59Piso0_005335 protein n=9 Tax=Dikarya TaxID=451864 RepID=G8Y1W9_PICSO
A0A060SZ67_BLAAD62.963%1352.32e-60ARAD1A18018p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A18018g PE=3 SV=1
COFI_YEAST57.639%1441.96e-59Cofilin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COF1 PE=1 SV=1
A0A0J9XLF6_GEOCN59.722%1442.77e-59Similar to Saccharomyces cerevisiae YLL050C COF1 Cofilin, involved in pH-dependent actin filament depolarization OS=Geotrichum candidum GN=BN980_GECA32s02463g PE=3 SV=1
A0A1D8PMW6_CANAL54.861%1441.19e-55Cofilin OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=COF1 PE=3 SV=1
MCA_05762_153.793%1454.37e-55MCA_05762_1
A0A167E6G9_9ASCO32.039%1036.66e-06Twf1p OS=Sugiyamaella lignohabitans GN=TWF1 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.0093

Protein family membership

Domains and repeats

1 20 40 60 80 100 120 140 150

Detailed signature matches

    1. cd11286 (ADF_cofili...)
    1. PF00241 (Cofilin_ADF)
    2. PS51263 (ADF_H)
    3. SM00102 (adf_2)
Unintegrated signatures no IPR
Unintegrated signatures
  1. SSF55753 (Actin dep...)

Residue annotation

  1. putative F-actin i...

Protein sequence

>MIA_01527_1
MYIITFLSIHSVVVADEAIEAFNELKQAKSKVKYVIYKLSEDLKSIVVDKKSTDSKYDDFVNDLPETDCRYAVYDFEYET
QSGEGIRNKLIFFSWSPDTAKVKSKMVYASSKDAIRRSLPGITNEIQGTDLDEIAYDTVLERVSRSAGSH

GO term prediction

Biological Process

GO:0030042 actin filament depolymerization

Molecular Function

GO:0003779 actin binding

Cellular Component

GO:0005622 intracellular
GO:0015629 actin cytoskeleton