Protein

MIA_01513_1

Length
253 amino acids

Browser: contig02:941449-942341-

Protein function

EGGNOG:0PIQWFG05365.1The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity)
SGD closest match:S000003367PRE9Proteasome subunit alpha type-3
CGD closest match:CAL0000190103PRE9Proteasome endopeptidase complex

Protein alignments

%idAln lengthE-value
MCA_00687_188.933%2531.34e-171MCA_00687_1
A0A0J9X979_GEOCN78.656%2535.89e-148Proteasome endopeptidase complex OS=Geotrichum candidum GN=BN980_GECA05s06335g PE=3 SV=1
A0A060T580_BLAAD73.518%2533.09e-139Proteasome endopeptidase complex OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B05368g PE=3 SV=1
Q6CBF1_YARLI70.751%2539.03e-137Proteasome endopeptidase complex OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_C19382g PE=3 SV=1
A0A1E3PSB0_9ASCO71.937%2531.83e-136Proteasome endopeptidase complex OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_44923 PE=3 SV=1
UniRef50_I8TH7471.315%2517.60e-131Proteasome subunit alpha type n=9 Tax=Eukaryota TaxID=2759 RepID=I8TH74_ASPO3
Q5AEB8_CANAL66.135%2516.55e-123Proteasome endopeptidase complex OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRE9 PE=3 SV=1
PSA3_YEAST65.182%2473.75e-119Proteasome subunit alpha type-3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRE9 PE=1 SV=1
A0A1E4TC32_9ASCO64.567%2548.04e-117Proteasome endopeptidase complex OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_138320 PE=3 SV=1
A0A167ES26_9ASCO66.310%1871.20e-93Proteasome endopeptidase complex OS=Sugiyamaella lignohabitans GN=PRE9 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.1080

Protein family membership

Domains and repeats

  1. Domain
  2. Domain
1 50 100 150 200 253

Detailed signature matches

  1. Family IPR001353
    Proteasome, subunit alpha/beta
    1. PF00227 (Proteasome)
  2. Family IPR023332
    Proteasome alpha-type subunit
    1. PS51475 (PROTEASOME...)
  3. Domain IPR029055
    Nucleophile aminohydrolases, N-terminal
    1. G3DSA:3.60.20.10
    2. SSF56235 (N-termina...)
  4. Domain IPR000426
    Proteasome alpha-subunit, N-terminal domain
    1. PS00388 (PROTEASOME...)
    2. PF10584 (Proteasome...)
    3. SM00948 (Proteasome...)
  5. SITE IPR016050
    Proteasome beta-type subunit, conserved site
    1. PS00854 (PROTEASOME...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. cd03752 (proteasome...)

Residue annotation

  1. alpha subunit inte...
  2. active site cd03752

Protein sequence

>MIA_01513_1
MGSRRYDSRTTIFSPEGRLYQVEYAQEAISHAGTAIGILARDGIVLAAENKVASKLLEQDISAEKMYTLNDHMVCSVAGI
TSDASILIQYARQFAQSYLRTYNENVPCEQLVRRLSDTKQAYTQHGGLRPYGVSFLYAGWDEINGYQLFMSNPSGNYSGW
KAASIGNNNSTAQTVLKQEYKEDLSLKEAVDLAIKVLSKTMDSSTLSSEKIEFATLGKSSHDPEKVVHKIWTPVEIDALL
EELGLAKPKEDDE

GO term prediction

Biological Process

GO:0006511 ubiquitin-dependent protein catabolic process
GO:0051603 proteolysis involved in cellular protein catabolic process

Molecular Function

GO:0004175 endopeptidase activity
GO:0004298 threonine-type endopeptidase activity

Cellular Component

GO:0005839 proteasome core complex
GO:0019773 proteasome core complex, alpha-subunit complex