Protein
MIA_01452_1
Length
282 amino acids
Browser: contig02:769344-770193+
Protein function
| EGGNOG: | 0PPH1 | VPH2 | Endoplasmic reticulum-based factor for assembly of V-ATPase |
|---|---|---|---|
| SGD closest match: | S000001602 | VPH2 | Vacuolar ATPase assembly integral membrane protein VPH2 |
| CGD closest match: | CAL0000185428 | VPH2 | Vph2p |
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| A0A0J9XG81_GEOCN | 47.771% | 157 | 1.99e-33 | Similar to Saccharomyces cerevisiae YKL119C VPH2 Integral membrane protein required for vacuolar H+-ATPase (V-ATPase) function OS=Geotrichum candidum GN=BN980_GECA13s00186g PE=4 SV=1 |
| UniRef50_A0A0J9XG81 | 47.771% | 157 | 4.08e-30 | Similar to Saccharomyces cerevisiae YKL119C VPH2 Integral membrane protein required for vacuolar H+-ATPase (V-ATPase) function n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XG81_GEOCN |
| A0A170QYL7_9ASCO | 38.189% | 254 | 3.91e-30 | Vph2p OS=Sugiyamaella lignohabitans GN=VPH2 PE=4 SV=1 |
| A0A060T5R8_BLAAD | 44.586% | 157 | 1.27e-22 | ARAD1B09526p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1B09526g PE=4 SV=1 |
| A0A1E3PN11_9ASCO | 31.621% | 253 | 7.92e-22 | Uncharacterized protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_50619 PE=4 SV=1 |
| Q6CI73_YARLI | 37.342% | 158 | 7.25e-15 | YALI0A01001p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_A01001g PE=4 SV=1 |
| MCA_00394_1 | 27.574% | 272 | 3.67e-13 | MCA_00394_1 |
| VPH2_YEAST | 38.938% | 113 | 1.53e-11 | Vacuolar ATPase assembly integral membrane protein VPH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VPH2 PE=1 SV=1 |
| A0A1D8PFF4_CANAL | 34.375% | 160 | 6.25e-08 | Vph2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=VPH2 PE=4 SV=1 |
| A0A1E4THE4_9ASCO | 30.968% | 155 | 3.50e-08 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_2883 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0317
Protein family membership
- ATPase, vacuolar ER assembly factor, Vma12 (IPR021013)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_01452_1 MVLLTVTPAIKAALESYHAQHTPQPLSEKPPSLNAPVTSLEKVPTDPPSLAAEKSAPTDTSSPDTLPPASAPALSHSQLI RLARQTRTPLVALLRNSAVYTPPPPPPPAKSPEYLALMARLRREAEESEYAQMVGDSMAAASSQPLTPGQEIKAVREQLT AIVNVAISVASVAYALWYCSGNYFHWDLPARTLLALFGAIVVLVAETVVYLRYHMRVDEARTVEQAKIEKKTFLQTLTEP HGVFASPSDDLDDLLPAVSTTTSTSTPKPNTRKRRVANHKKN
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.