Protein

MIA_01416_1

Length
191 amino acids

Browser: contig02:662820-663528+

Protein function

EGGNOG:0PFM2SAR1Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). The coat has two main functions, the physical deformation of the endoplasmic reticulum membrane into vesicles and the selection of cargo molecules. SAR1 controls the coat assembly in a stepwise manner. Activated SAR1-GTP binds to membranes first and recruits the SEC23 24 complex. These SEC23 24-SAR1 prebudding intermediates are then collected by the SEC13 31 complex as subunits polymerize to form coated transport vesicles. Conversion to SAR1-GDP triggers coat release and recycles COPII subunits (By similarity)
SGD closest match:S000006139SAR1Small COPII coat GTPase SAR1
CGD closest match:CAL0000177161SAR1Small COPII coat GTPase SAR1

Protein alignments

%idAln lengthE-value
MCA_02279_162.827%1916.28e-77MCA_02279_1
A0A060TCN9_BLAAD59.788%1893.45e-73ARAD1D44396p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D44396g PE=3 SV=1
SAR1_YARLI59.788%1899.10e-73Small COPII coat GTPase SAR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SAR1 PE=3 SV=1
UniRef50_Q2HA5560.428%1878.82e-69Small COPII coat GTPase SAR1 n=210 Tax=Fungi TaxID=4751 RepID=SAR1_CHAGB
A0A1E3PP64_9ASCO60.317%1894.53e-71Putative small monomeric GTPase SarA OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_81780 PE=3 SV=1
A0A1E4TF50_9ASCO60.317%1891.23e-70Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_105162 PE=3 SV=1
SAR1_CANAL57.143%1898.13e-70Small COPII coat GTPase SAR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SAR1 PE=3 SV=2
A0A0J9XDJ3_GEOCN59.016%1831.41e-67Similar to Saccharomyces cerevisiae YPL218W SAR1 GTPase, GTP-binding protein of the ARF family OS=Geotrichum candidum GN=BN980_GECA11s03530g PE=3 SV=1
SAR1_YEAST58.511%1887.72e-66Small COPII coat GTPase SAR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SAR1 PE=1 SV=1
A0A167DBV5_9ASCO33.898%1771.54e-25Arf family GTPase ARF2 OS=Sugiyamaella lignohabitans GN=ARF2 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.2282

Protein family membership

Domains and repeats

  1. Domain
1 20 40 60 80 100 120 140 160 180 191

Detailed signature matches

  1. Family IPR006689
    Small GTPase superfamily, ARF/SAR type
    1. PF00025 (Arf)
    2. PR00328 (SAR1GTPBP)
  2. Family IPR006687
    Small GTPase superfamily, SAR1-type
    1. PS51422 (SAR1)
  3. Domain IPR027417
    P-loop containing nucleoside triphosphate hydrolase
    1. SSF52540 (P-loop co...)
  4. Domain IPR005225
    Small GTP-binding protein domain
    1. TIGR00231
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.40.50...
  2. SM00177 (arf_sub_2)
  3. SM00178 (sar_sub_1)
  4. cd00879 (Sar1)

Residue annotation

  1. STAR motif cd00879
  2. G1 box cd00879
  3. GAP interaction si...
  4. GTP/Mg2+ binding s...
  5. Switch I region cd...
  6. G2 box cd00879
  7. putative GEF inter...
  8. putative effector ...
  9. interswitch region...
  10. G3 box cd00879
  11. Switch II region c...
  12. G4 box cd00879
  13. G5 box cd00879

Protein sequence

>MIA_01416_1
MAWLFDWIFDVLYSLGLYNKKARLVFLGLDNAGKTALLHMLKNDQFESPGPTYSPKLEEIIFNNIQFSVFDLGGHTAARR
LWKDYITEVNGLVFLVDAADRARLPECKTELDALLAIPGLMPGPLLILGNKTDLPDAASEDELREALGLYQTTGKNADYL
DPAVQPVELFMSSVLKRQGYLDGFSWLSRHI

GO term prediction

Biological Process

GO:0006886 intracellular protein transport

Molecular Function

GO:0005525 GTP binding

Cellular Component

GO:0005622 intracellular