Protein

MIA_01414_1

Length
131 amino acids


Browser: contig02:658340-658736-

Protein function

EGGNOG:0PNPGRPL3260S ribosomal protein L32
SGD closest match:S000000188RPL3260S ribosomal protein L32

Protein alignments

%idAln lengthE-value
A0A0J9XF24_GEOCN72.308%1301.12e-67Similar to Saccharomyces cerevisiae YBL092W RPL32 Protein component of the large (60S) ribosomal subunit OS=Geotrichum candidum GN=BN980_GECA11s02243g PE=4 SV=1
A0A060T322_BLAAD74.016%1272.87e-64ARAD1A12694p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A12694g PE=4 SV=1
A0A1E3PQT2_9ASCO69.841%1261.82e-6260S ribosomal protein L32 OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_21891 PE=4 SV=1
A0A167DRI2_9ASCO74.803%1271.44e-60Ribosomal 60S subunit protein L32 OS=Sugiyamaella lignohabitans GN=RPL32 PE=4 SV=1
Q6C406_YARLI68.504%1271.06e-59YALI0E30811p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_E30811g PE=4 SV=1
RL32_YEAST61.069%1319.06e-5560S ribosomal protein L32 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL32 PE=1 SV=1
UniRef50_P3806161.069%1312.17e-5160S ribosomal protein L32 n=368 Tax=Eukaryota TaxID=2759 RepID=RL32_YEAST
A0A1D8PPN6_CANAL64.062%1281.86e-54Ribosomal 60S subunit protein L32 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RPL32 PE=4 SV=1
A0A1E4TAR3_9ASCO59.542%1313.73e-49Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_129557 PE=4 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.3363
Predicted cleavage: 22

Protein family membership

Domains and repeats

None predicted.

Detailed signature matches

    1. SM01393 (Ribosomal_...)
    2. PF01655 (Ribosomal_...)
    3. cd00513 (Ribosomal_...)
    4. SSF52042 (Ribosomal...)
    1. PS00580 (RIBOSOMAL_...)
Unintegrated signatures no IPR
Unintegrated signatures
  1. mobidb-lite (disord...)

Residue annotation

  1. 23S rRNA interface...

Protein sequence

>MIA_01414_1
MALAPHPKIVKKHGNKKFKRHHSDRYARVGESWRKPKGIDSAVRRRFRGTVRMPKIGYGSDKRTKYLAPSGLKSVVVSNA
AELDTLILSNKYFAAEIAHSVSSRKRAEIVEKAKTLSIHVTNASARLSSQA

GO term prediction

Biological Process

GO:0006412 translation

Molecular Function

GO:0003735 structural constituent of ribosome

Cellular Component

GO:0005622 intracellular
GO:0005840 ribosome