Protein
MIA_01312_1
Length
188 amino acids
Browser: contig02:336493-337149+
Protein function
EGGNOG: | 0PI6A | FG10152.1 | Unfolded protein response protein Orm1 |
---|---|---|---|
SGD closest match: | S000003270 | ORM1 | Protein ORM1 |
CGD closest match: | CAL0000201445 | ORM1 | Sphingolipid homeostasis protein |
Protein alignments
%id | Aln length | E-value | ||
---|---|---|---|---|
MCA_05946_1 | 84.211% | 190 | 1.18e-119 | MCA_05946_1 |
A0A167CYC3_9ASCO | 81.977% | 172 | 5.21e-110 | Orm1p OS=Sugiyamaella lignohabitans GN=ORM1 PE=4 SV=1 |
A0A060SY39_BLAAD | 78.857% | 175 | 1.37e-108 | ARAD1A17710p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1A17710g PE=4 SV=1 |
A0A0J9XC11_GEOCN | 78.212% | 179 | 1.94e-108 | Similar to Saccharomyces cerevisiae YGR038W ORM1 Evolutionarily conserved protein, similar to Orm2p,required for resistance to agents that induce unfolded protein response OS=Geotrichum candidum GN=BN980_GECA09s03662g PE=4 SV=1 |
Q6CE68_YARLI | 77.143% | 175 | 2.09e-102 | YALI0B18150p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_B18150g PE=4 SV=1 |
UniRef50_Q6CE68 | 77.143% | 175 | 4.84e-99 | YALI0B18150p n=128 Tax=Fungi TaxID=4751 RepID=Q6CE68_YARLI |
A0A1E3PEY7_9ASCO | 82.530% | 166 | 3.88e-97 | Orm1 type endoplasmic reticulum protein OS=Nadsonia fulvescens var. elongata DSM 6958 GN=NADFUDRAFT_52971 PE=4 SV=1 |
A0A1E4TD46_9ASCO | 70.588% | 170 | 1.34e-94 | Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_141442 PE=4 SV=1 |
ORM1_YEAST | 66.456% | 158 | 4.05e-76 | Protein ORM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ORM1 PE=1 SV=1 |
Q5A8J7_CANAL | 59.538% | 173 | 6.95e-73 | Sphingolipid homeostasis protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ORM1 PE=4 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.0622
Predicted cleavage: 19
Protein family membership
- ORMDL family (IPR007203)
Domains and repeats
None predicted.
Detailed signature matches
-
-
PIRSF018147 (ORM1)
-
PF04061 (ORMDL)
-

Unintegrated signatures
-
CYTOPLASMIC_D... (C...)
-
NON_CYTOPLASM... (N...)
-
TRANSMEMBRANE (Tran...)
-
mobidb-lite (disord...)
Protein sequence
>MIA_01312_1 MTASLSVSEKPGHNRRRSSSIINHIEPETIEEQTDQASLPNLNADWVNNKGAWVIHIVVIVMLKIFYDLLPGVTQELSWT LTNITYVTGSYVMFHYVKGIPFEFNGGAYDNLTMWEQIDDGDQYTPAKKFLLGVPIGLFLISTHYTHYDITMFVLNCLAC LFVVIPKLPSSHRLRISVPGYATPVSED
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
GO:0005789 endoplasmic reticulum membrane
GO:0016021 integral component of membrane