Protein

MIA_01246_1

Length
236 amino acids

Browser: contig02:160177-160888+

Protein function

EGGNOG:0PHFENUIMoxidoreductase 23 kDa subunit
CGD closest match:CAL0000196894orf19.4758Uncharacterized protein

Protein alignments

%idAln lengthE-value
A0A0J9XDJ9_GEOCN92.553%1889.73e-136NUIM subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I), putative OS=Geotrichum candidum GN=BN980_GECA10s03684g PE=3 SV=1
MCA_05978_178.926%2421.88e-135MCA_05978_1
A0A167E7S7_9ASCO91.351%1851.90e-131NADH dehydrogenase (Ubiquinone) Fe-S protein 8 OS=Sugiyamaella lignohabitans GN=NUO1 PE=3 SV=1
F2Z619_YARLI89.714%1756.44e-119YALI0F00924p OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YALI0_F00924g PE=3 SV=1
A0A060THX2_BLAAD83.333%1861.50e-118ARAD1D41426p OS=Blastobotrys adeninivorans GN=GNLVRS02_ARAD1D41426g PE=3 SV=1
UniRef50_E1UWB383.243%1855.04e-113NUIM (TYKY) subunit of mitochondrial NADH:ubiquinone oxidoreductase (Complex I) n=28 Tax=Eukaryota TaxID=2759 RepID=E1UWB3_PICPA
A0A1D8PEH4_CANAL81.622%1852.26e-114Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=orf19.4758 PE=3 SV=1
A0A1E4TE27_9ASCO79.781%1831.48e-107Uncharacterized protein OS=Tortispora caseinolytica NRRL Y-17796 GN=CANCADRAFT_25437 PE=3 SV=1

Mitochondrial localization by mitoprotII

Probability of mitochondrial location: 0.8870
Predicted cleavage: 68

Protein family membership

Domains and repeats

  1. Domain
1 50 100 150 200 236

Detailed signature matches

  1. Family IPR010226
    NADH-quinone oxidoreductase, chain I
    1. MF_01351 (NDH1_NuoI)
    2. TIGR01971
  2. Domain IPR017896
    4Fe-4S ferredoxin-type, iron-sulphur binding domain
    1. PS51379 (4FE4S_FER_2)
    2. PF12838 (Fer4_7)
  3. SITE IPR017900
    4Fe-4S ferredoxin, iron-sulphur binding, conserved site
    1. PS00198 (4FE4S_FER_1)
Unintegrated signatures no IPR
Unintegrated signatures
  1. G3DSA:3.30.70.20
  2. SSF54862 (4Fe-4S fe...)

Protein sequence

>MIA_01246_1
MLVRQTLRQGMMASRGAAFIRQPTISAIKFYSTPSTTTTTTTASSSPSFPVGTAEGVPPLGYRIHRPPTWEESHESALDK
ATKFFLLAEMFRGMYVVLEQFFRAPYTIYYPFEKGPISARFRGEHALRRYPSGEERCIACKLCEAICPAMAITIEAEERA
DGSRRTTKYDIDMTKCIYCGYCQESCPVDAIVETPNVEYSTETREELLYNKEKLLANGDKWEQEIQYGLDADSHYR

GO term prediction

Biological Process

GO:0055114 oxidation-reduction process

Molecular Function

GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0051539 4 iron, 4 sulfur cluster binding

Cellular Component

GO:0016020 membrane