Protein
MIA_01245_1
Length
154 amino acids
Browser: contig02:158843-159364-
Protein alignments
| %id | Aln length | E-value | ||
|---|---|---|---|---|
| MCA_05979_1 | 47.368% | 152 | 1.17e-28 | MCA_05979_1 |
| A0A060TCF1_BLAAD | 35.616% | 146 | 6.02e-12 | Regulator of rDNA transcription 14 OS=Blastobotrys adeninivorans GN=RRT14 PE=3 SV=1 |
| UniRef50_A0A060TCF1 | 35.616% | 146 | 1.49e-08 | Regulator of rDNA transcription 14 n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060TCF1_BLAAD |
| A0A0J9XDK3_GEOCN | 30.709% | 127 | 9.67e-11 | Regulator of rDNA transcription 14 OS=Geotrichum candidum GN=RRT14 PE=3 SV=1 |
Mitochondrial localization by mitoprotII
Probability of mitochondrial location: 0.3276
Protein family membership
- Regulator of rDNA transcription 14 (IPR031404)
Domains and repeats
None predicted.
Detailed signature matches
no IPR
Unintegrated signatures
-
-
mobidb-lite (disord...)
Protein sequence
>MIA_01245_1 MSSETASKRSEATLGRLLASYLPDERTKIIQKRTKKSTANRKSRKLLRDRQAVVKDALDPKKLKEKREKAKKENIKTLAS WDAENEIDEIKDHIIQMRNAKSKKTQTGSSDLYESSKADYFESKTFSSSSGSKERSWPGLTPGLAPVDYESDSE
GO term prediction
Biological Process
None predicted.
Molecular Function
None predicted.
Cellular Component
None predicted.